ErmN

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000592
Synonym(s)tlrD
CARD Short NameErmN
DefinitionErmN is a methyltransferase found in the tylosin producer Streptomyces fradiae. Like other Erm enzymes, it catalyzes the methylation of A2058 of the 23S ribosomal RNA. Specifically, this enzyme transfers only one methyl group. The gene is found in the tylosin biosynthetic cluster and is responsible for self-resistance to tylosin.
AMR Gene FamilyErm-like 23S rRNA methyltransferase
Drug Classstreptogramin antibiotic, lincosamide antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target alteration
Classification15 ontology terms | Show
Parent Term(s)25 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ Erm-like 23S rRNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic pristinamycin IA [Antibiotic]
+ confers_resistance_to_antibiotic quinupristin [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin M1 [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IB [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin S2 [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IC [Antibiotic]
+ confers_resistance_to_antibiotic vernamycin C [Antibiotic]
+ confers_resistance_to_antibiotic patricin A [Antibiotic]
+ confers_resistance_to_antibiotic patricin B [Antibiotic]
+ confers_resistance_to_antibiotic ostreogrycin B3 [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Publications

Liu M, et al. 2002. Antimicrob Agents Chemother 46(6): 1629-1633. Activity of the ketolide telithromycin is refractory to Erm monomethylation of bacterial rRNA. (PMID 12019067)

Gandecha AR and Cundliffe E. 1996. Gene 180(1-2): 173-176. Molecular analysis of tlrD, an MLS resistance determinant from the tylosin producer, Streptomyces fradiae. (PMID 8973363)

Liu M, et al. 2002. Proc Natl Acad Sci U S A 99(23): 14658-14663. Resistance to the macrolide antibiotic tylosin is conferred by single methylations at 23S rRNA nucleotides G748 and A2058 acting in synergy. (PMID 12417742)

Resistomes

Prevalence of ErmN among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|CAA66307.2|+|ErmN [Streptomyces fradiae]
MPSRPRTDSPHRHEGPAGPARLDRDEARRVWGQNFFRSAGSARRFARQLTGAESAGNDSVTVEVGPGAGRITKELVRDGHPIVAVEVDPH
WADRLAELELPNLTVVNDDFTTWPLPDGPLRFIGNLPFGTGTRMLRRCLALGPDRCREGVFLLQKQYTRKRTGAYGGNLFNAQWEPWYTF
RRGLGFPRQEFAPVPGSDTETLLVRSRPRPLAPWSRHAAYQRFVEDVFNTSRLTIGEAARALDRRAGPGWLRGARVPPGLRVKDITAEQW
ADLFHACTPPPARRISPQRRR


>gb|X97721.2|+|160-1035|ErmN [Streptomyces fradiae]
ATGCCGTCCCGGCCACGTACCGATTCGCCCCACCGGCACGAGGGGCCGGCCGGCCCGGCCCGTCTCGACCGGGACGAGGCCCGCCGTGTA
TGGGGCCAGAATTTCTTCCGCTCGGCGGGTTCGGCCCGCCGTTTCGCCCGGCAGTTGACCGGCGCGGAATCGGCCGGAAACGACTCGGTC
ACCGTCGAGGTGGGTCCCGGGGCCGGCCGTATCACCAAGGAGTTAGTGAGGGACGGTCATCCGATCGTCGCGGTGGAGGTGGACCCCCAT
TGGGCCGACCGCCTCGCCGAACTGGAACTGCCGAACCTCACCGTCGTCAACGACGACTTCACGACCTGGCCGCTGCCCGACGGGCCGCTG
CGGTTCATCGGCAATCTGCCCTTCGGCACCGGCACCAGGATGCTCCGCCGCTGCCTCGCCCTCGGCCCGGACCGCTGCCGCGAAGGCGTG
TTCCTTCTCCAGAAGCAGTACACGCGCAAGCGCACCGGTGCCTACGGCGGCAATCTCTTCAACGCCCAGTGGGAGCCCTGGTACACGTTC
CGCCGCGGACTGGGCTTCCCCCGGCAGGAGTTCGCCCCGGTCCCGGGCTCCGACACCGAGACCCTGCTGGTGAGATCGCGCCCGCGCCCG
CTGGCGCCCTGGTCCCGCCATGCCGCCTACCAGCGGTTCGTGGAGGACGTGTTCAACACCTCCCGGCTCACCATCGGTGAGGCCGCCCGC
GCGCTGGACCGCCGGGCCGGCCCGGGCTGGCTCCGGGGCGCGCGGGTGCCTCCCGGGTTGCGGGTCAAGGACATCACGGCCGAGCAGTGG
GCCGATCTCTTCCACGCGTGCACCCCGCCGCCCGCCCGGCGCATCTCGCCGCAGCGGAGGCGCTGA

Curator Acknowledgements
Curator Description Most Recent Edit