ErmQ

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000593
CARD Short NameErmQ
DefinitionErmQ confers MLSb phenotype.
AMR Gene FamilyErm-like 23S rRNA methyltransferase
Drug Classstreptogramin antibiotic, lincosamide antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target alteration
Classification15 ontology terms | Show
Parent Term(s)25 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ Erm-like 23S rRNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic pristinamycin IA [Antibiotic]
+ confers_resistance_to_antibiotic quinupristin [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin M1 [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IB [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin S2 [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IC [Antibiotic]
+ confers_resistance_to_antibiotic vernamycin C [Antibiotic]
+ confers_resistance_to_antibiotic patricin A [Antibiotic]
+ confers_resistance_to_antibiotic patricin B [Antibiotic]
+ confers_resistance_to_antibiotic ostreogrycin B3 [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Resistomes with Perfect MatchesClostridium perfringensg+p+wgs, Paraclostridium sordelliiwgs, Peptacetobacter hiranonisg
Resistomes with Sequence VariantsClostridium perfringensg+p+wgs, Paraclostridium sordelliiwgs, Peptacetobacter hiranonisg
Publications

Berryman DI, et al. 1994. Antimicrob Agents Chemother 38(5): 1041-1046. Cloning and sequence analysis of ermQ, the predominant macrolide-lincosamide-streptogramin B resistance gene in Clostridium perfringens. (PMID 8067735)

Resistomes

Prevalence of ErmQ among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Clostridium perfringens5%1.93%11.25%0%0%
Paraclostridium sordellii0%0%1.69%0%0%
Peptacetobacter hiranonis100%0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAC36915.1|+|ErmQ [Clostridium perfringens]
MKAKSNNYRGKVDISVSQNFITSKNTIYKLIKKTNISKNDFVIEIGPGKGHITEALCEKSYWVTAIELDRSLYGNLINKFKSKNNVTLIN
KDFLNWKLPKKREYKVFSNIPFYITTKIIKKLLLEELNSPTDMWLVMEKGSAKRFMGIPRESKLSLLLKTKFDIKIVHYFNREDFHPMPS
VDCVLVYFKRKYKYDISKDEWNEYTSFISKSINNLRDVFTKNQIHAVIKYLGINLNNISEVSYNDWIQLFRYKQKID


>gb|L22689.1|+|262-1035|ErmQ [Clostridium perfringens]
ATGAAAGCTAAAAGTAATAATTATAGAGGAAAAGTTGATATTAGTGTATCGCAAAATTTTATTACTAGTAAAAATACTATATATAAATTA
ATAAAAAAAACAAATATATCCAAAAATGATTTTGTTATTGAAATTGGACCAGGAAAAGGTCATATAACAGAAGCTTTATGTGAAAAAAGT
TATTGGGTTACAGCTATAGAACTAGATAGAAGTTTATATGGAAATTTAATAAATAAATTTAAAAGTAAAAATAATGTTACTCTTATTAAT
AAAGATTTTTTAAATTGGAAATTACCTAAAAAAAGAGAATATAAGGTATTTTCTAATATTCCTTTTTATATAACAACAAAGATTATTAAG
AAATTATTATTAGAAGAGTTAAATTCACCAACTGATATGTGGCTAGTTATGGAGAAAGGTTCCGCAAAAAGATTTATGGGAATACCTAGA
GAGAGTAAATTATCATTACTTTTAAAAACTAAATTTGATATTAAGATAGTGCACTATTTTAATAGAGAAGACTTCCATCCCATGCCTAGT
GTAGATTGCGTCTTAGTATATTTTAAAAGAAAATATAAATATGATATATCTAAAGATGAATGGAATGAATATACAAGTTTTATATCTAAG
TCTATTAATAACTTAAGAGATGTATTTACAAAAAATCAAATTCATGCAGTAATTAAATACCTAGGTATAAATCTTAATAATATTAGTGAA
GTTTCTTATAATGATTGGATACAGTTATTTAGATATAAACAAAAGATAGATTAG

Curator Acknowledgements
Curator Description Most Recent Edit