Pseudomonas mutant PhoQ conferring resistance to colistin

Accession ARO:3003896
DefinitionMutations in Pseudomonas aeruginosa PhoQ of the two-component PhoPQ regulatory system. Presence of mutation confers resistance to colistin
AMR Gene Familypmr phosphoethanolamine transferase, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, nitroimidazole antibiotic, tetracycline antibiotic, macrolide antibiotic, penam, acridine dye, cephalosporin, fluoroquinolone antibiotic, pleuromutilin antibiotic, rifamycin antibiotic
Resistance Mechanismantibiotic target alteration, antibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Classification37 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic colistin A [Antibiotic]
+ confers_resistance_to_antibiotic colistin B [Antibiotic]
+ phoQ
Publications

Lee JY, et al. 2014. Diagn Microbiol Infect Dis 78(3): 271-276. Mutations and expression of PmrAB and PhoPQ related with colistin resistance in Pseudomonas aeruginosa clinical isolates. (PMID 24412662)

Resistomes

Prevalence of Pseudomonas mutant PhoQ conferring resistance to colistin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 860

PMID: 24412662K123Q V260G

>gb|AAG04569.1|+|Pseudomonas mutant PhoQ conferring resistance to colistin [Pseudomonas aeruginosa PAO1]
MIRSLRIRLMLGAAALAVLFMLALLPALQRAFGIALENTIEQRLAADVATLVSAARVEKG
RLVMPEHLPVEEFNLPEAKVLGYIYDQNGDLLWRSTSAADESINYTPRYDGRGNEFHTTR
DAKGEEFFVFDVEIDLLRGKQAAYSIVTMQSVSEFESLLKGFREQLYLWLGGALLVLLGL
LWLGLTWGFRAMRGLSSELDQIESGERESLSEEHPRELLRLTHSLNRLLRSEHKQRERYR
HSLGDLAHSLKTPLAVLQGVGDQLAEEPGNREQVRVLQGQIERMSQQIGYQLQRASLRKS
GLVRHREQLAPLVETLCDALDKVYRDKRVSLQRDFSPSFSVPVERGALLELLGNLLENAY
RLCLGRVRVGARLGPGYSELWVEDDGPGVPAEQRARIIRRGERADTQHPGQGIGLAVALD
IIESYDGELSLDDSELGGACFRIRFATV



>gb|AE004091.2|+|1278362-1279708|Pseudomonas mutant PhoQ conferring resistance to colistin [Pseudomonas aeruginosa PAO1]
GTGATCCGTTCCCTGCGCATCCGTCTGATGCTCGGCGCCGCCGCCCTGGCGGTGCTGTTCATGCTGGCGCTGCTGCCGGCCCTGCAGCGG
GCCTTCGGCATCGCCCTGGAGAACACCATCGAGCAGCGCCTGGCCGCCGACGTGGCGACCCTGGTCTCGGCGGCGCGGGTGGAGAAGGGC
CGCCTGGTGATGCCCGAGCACCTGCCGGTGGAGGAGTTCAACCTGCCGGAGGCCAAGGTCCTCGGCTATATCTACGACCAGAATGGCGAT
CTGCTCTGGCGCTCCACCTCGGCGGCCGACGAGTCGATCAACTACACGCCGCGCTACGACGGCCGCGGCAACGAATTCCACACCACCCGC
GATGCGAAGGGCGAGGAGTTCTTCGTGTTCGACGTCGAGATCGACCTGCTGCGCGGCAAGCAGGCGGCCTACAGCATCGTCACCATGCAA
TCGGTCAGCGAGTTCGAGAGCCTGCTCAAGGGGTTCCGCGAGCAGCTCTACCTGTGGCTCGGCGGCGCCCTGCTGGTCTTGCTCGGGCTG
CTCTGGCTGGGTCTGACCTGGGGCTTCCGGGCGATGCGCGGGTTGAGTTCCGAGCTGGACCAGATCGAATCCGGCGAGCGCGAGAGCCTG
AGCGAGGAGCATCCGCGCGAGCTGCTGCGCCTGACCCACTCGCTTAACCGCCTGTTGCGCAGCGAGCACAAACAGCGCGAGCGCTACCGC
CACTCCCTCGGCGACCTGGCGCACAGTCTGAAGACGCCGCTGGCGGTCTTGCAGGGGGTCGGCGACCAGCTCGCCGAGGAGCCCGGCAAC
CGCGAGCAGGTGCGGGTGCTACAGGGCCAGATCGAGCGCATGAGCCAGCAGATAGGCTATCAGTTGCAGCGCGCCAGCCTGCGCAAGAGC
GGCCTGGTACGCCATCGCGAGCAACTGGCGCCGCTGGTGGAGACCCTGTGCGACGCGCTGGACAAGGTCTATCGCGACAAGCGGGTAAGC
CTGCAGCGGGACTTCTCGCCGTCCTTCAGCGTGCCGGTGGAGCGCGGCGCGCTGCTGGAACTGCTCGGCAACCTGCTGGAGAACGCCTAT
CGCCTGTGCCTGGGCCGGGTCCGCGTGGGCGCCCGGCTGGGGCCGGGTTACTCGGAGCTGTGGGTCGAGGACGACGGTCCCGGAGTGCCT
GCCGAACAGCGCGCACGAATCATCCGCCGCGGCGAGCGCGCCGATACCCAGCACCCGGGGCAGGGCATCGGCCTGGCCGTGGCGCTGGAC
ATCATCGAGAGCTACGACGGCGAACTGAGCCTGGACGATTCCGAGCTGGGCGGCGCCTGCTTCCGCATACGTTTCGCTACAGTCTGA