Accession ARO:3000375
Synonym(s)ermBC erm ermBP ermAM ermBZ1 ermP ermBZ2 ermIP ermAMR erm2
DefinitionErmB confers the MLSb phenotype. Similar to ErmC, expression of ErmB is inducible by erythromycin. The leader peptide causes attenuation of the mRNA and stabilizes the structure preventing further translation. When erythromycin is present, it binds the leader peptide causing a change in conformation allowing for the expression of ErmB.
AMR Gene FamilyErm 23S ribosomal RNA methyltransferase
Drug Classstreptogramin antibiotic, macrolide antibiotic, lincosamide antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesEnterococcus faeciumwgs
Classification14 ontology terms | Show
Parent Term(s)25 ontology terms | Show
+ Erm 23S ribosomal RNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IIA [Antibiotic]
+ confers_resistance_to_antibiotic ostreogrycin B3 [Antibiotic]
+ confers_resistance_to_antibiotic patricin A [Antibiotic]
+ confers_resistance_to_antibiotic patricin B [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IA [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IB [Antibiotic]
+ confers_resistance_to_antibiotic quinupristin [Antibiotic]
+ confers_resistance_to_antibiotic vernamycin B-gamma [Antibiotic]
+ confers_resistance_to_antibiotic vernamycin C [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin S2 [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Publications

Min YH, et al. 2008. Antimicrob Agents Chemother 52(5): 1782-1789. Translational attenuation and mRNA stabilization as mechanisms of erm(B) induction by erythromycin. (PMID 18299414)

Yu L, et al. 1997. Nat Struct Biol 4(6): 483-489. Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance. (PMID 9187657)

Hajduk PJ, et al. 1999. J Med Chem 42(19): 3852-3859. Novel inhibitors of Erm methyltransferases from NMR and parallel synthesis. (PMID 10508434)

Resistomes

Prevalence of ErmB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.05%
Campylobacter coli2.78%0%1.31%
Campylobacter jejuni0.57%0%0.14%
Clostridioides difficile29.23%0%25.72%
Clostridium perfringens6.25%0%1.67%
Enterobacter hormaechei0%0%0.12%
Enterococcus faecalis8.47%22.22%49.8%
Enterococcus faecium1.32%16.32%57.36%
Escherichia coli0.09%0.42%1.65%
Klebsiella pneumoniae0%0.32%1.78%
Salmonella enterica0.1%0.18%0.05%
Shigella flexneri0%9.21%8.47%
Shigella sonnei0%4.84%0.62%
Staphylococcus aureus1.23%0.26%2.45%
Staphylococcus pseudintermedius26.67%0%69.3%
Streptococcus agalactiae8.7%0%17.1%
Streptococcus anginosus0%0%6.15%
Streptococcus pneumoniae18.25%0%11.87%
Streptococcus pyogenes3.4%0%2.58%
Vibrio parahaemolyticus0%0%0.14%
Vibrio vulnificus0%0%1.25%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|AAF86219.1|+|ErmB [Enterococcus faecium] Partial
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFP
NKQRYKIVGSIPYNLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTT
DVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRKLIL


>gb|AF242872.1|+|2132-2878|ErmB [Enterococcus faecium] Partial
ATGAACAAAAATATAAAATATTCTCAAAACTTTTTAACGAGTGAAAAAGTACTCAACCAAATAATAAAACAATTGAATTTAAAAGAAACC
GATACCGTTTACGAAATTGGAACAGGTAAAGGGCATTTAACGACGAAACTGGCTAAAATAAGTAAACAGGTAACGTCTATTGAATTAGAC
AGTCATCTATTCAACTTATCGTCAGAAAAATTAAAACTGAATACTCGTGTCACTTTAATTCACCAAGATATTCTACAGTTTCAATTCCCT
AACAAACAGAGGTATAAAATTGTTGGGAGTATTCCTTACAATTTAAGCACACAAATTATTAAAAAAGTGGTTTTTGAAAGCCGTGCGTCT
GACATCTATCTGATTGTTGAAGAAGGATTCTACAAGCGTACCTTGGATATTCACCGAACACTAGGGTTGCTCTTGCACACTCAAGTCTCG
ATTCAGCAATTGCTTAAGCTGCCAGCGGAATGCTTTCATCCTAAACCAAAAGTAAACAGTGTCTTAATAAAACTTACCCGCCATACCACA
GATGTTCCAGATAAATATTGGAAGCTATATACGTACTTTGTTTCAAAATGGGTCAATCGAGAATATCGTCAACTGTTTACTAAAAATCAG
TTTCATCAAGCAATGAAACACGCCAAAGTAAACAATTTAAGTACCATTACTTATGAGCAAGTATTGTCTATTTTTAATAGTTATCTATTA
TTTAACGGGAGGAAATTAATTCTATGA