Accession ARO:3000375
Synonym(s)ermBC erm ermBP ermBZ1 ermAM ermP ermBZ2 ermIP ermAMR erm2
CARD Short NameErmB
DefinitionErmB confers the MLSb phenotype. Similar to ErmC, expression of ErmB is inducible by erythromycin. The leader peptide causes attenuation of the mRNA and stabilizes the structure preventing further translation. When erythromycin is present, it binds the leader peptide causing a change in conformation allowing for the expression of ErmB.
AMR Gene FamilyErm 23S ribosomal RNA methyltransferase
Drug Classstreptogramin antibiotic, macrolide antibiotic, lincosamide antibiotic, streptogramin A antibiotic, streptogramin B antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Perfect MatchesEnterococcus faeciumwgs
Resistomes with Sequence VariantsAcinetobacter baumanniip+wgs, Acinetobacter townerip, Anaerostipes hadrusg+wgs, Bacillus subtilisg+wgs, Bacillus thuringiensiswgs, Bacteroides caccaewgs, Bacteroides fragilisg+wgs, Bacteroides ovatuswgs, Bacteroides thetaiotaomicronwgs, Bifidobacterium brevewgs, Butyricimonas faecalisg, Campylobacter colig+wgs, Campylobacter jejunig+wgs, Citrobacter amalonaticusp, Citrobacter freundiiwgs, Clostridium perfringensg+wgs, Collinsella aerofacienswgs, Eggerthella lentag+wgs, Enterobacter chengduensiswgs, Enterobacter hormaecheiwgs, Enterocloster clostridioformiswgs, Enterococcus aviump+wgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs, Enterococcus hiraeg+p+wgs, Erysipelatoclostridium ramosumwgs, Escherichia colig+p+wgs, Eubacterium maltosivoransg, Faecalibacterium prausnitziig+wgs, Fusobacterium nucleatumg, Gemella morbillorumg+wgs, Jeotgalibaca arthritidisg, Klebsiella oxytocap, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Lactobacillus crispatusg+wgs, Lactobacillus inersg+wgs, Lactobacillus johnsoniig+wgs, Lactococcus garvieaep, Listeria innocuap, Listeria monocytogeneswgs, Megasphaera stantoniiwgs, Phocaeicola doreig+wgs, Phocaeicola massiliensiswgs, Phocaeicola vulgatuswgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Shigella boydiiwgs, Shigella flexnerip+wgs, Shigella sonneip+wgs, Staphylococcus arlettaewgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidiswgs, Staphylococcus haemolyticuswgs, Staphylococcus pseudintermediusg+wgs, Staphylococcus saprophyticuswgs, Staphylococcus warneriwgs, Streptococcus agalactiaeg+wgs, Streptococcus anginosusg+wgs, Streptococcus caniswgs, Streptococcus cristatusg+wgs, Streptococcus dysgalactiaeg+wgs, Streptococcus equiwgs, Streptococcus gallolyticuswgs, Streptococcus gordoniig+wgs, Streptococcus gwangjuenseg, Streptococcus iniaep+wgs, Streptococcus intermediusg+wgs, Streptococcus lutetiensisg+wgs, Streptococcus mitiswgs, Streptococcus mutansp+wgs, Streptococcus pasteurianusg+wgs, Streptococcus pneumoniaeg+wgs, Streptococcus porcinuswgs, Streptococcus pseudopneumoniaeg+wgs, Streptococcus pyogenesg+wgs, Streptococcus sanguiniswgs, Streptococcus suisg+wgs, Treponema denticolawgs, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs
Classification14 ontology terms | Show
Parent Term(s)25 ontology terms | Show
+ Erm 23S ribosomal RNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin M1 [Antibiotic]
+ confers_resistance_to_antibiotic ostreogrycin B3 [Antibiotic]
+ confers_resistance_to_antibiotic patricin A [Antibiotic]
+ confers_resistance_to_antibiotic patricin B [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IA [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IB [Antibiotic]
+ confers_resistance_to_antibiotic quinupristin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IC [Antibiotic]
+ confers_resistance_to_antibiotic vernamycin C [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin S2 [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Publications

Min YH, et al. 2008. Antimicrob Agents Chemother 52(5): 1782-1789. Translational attenuation and mRNA stabilization as mechanisms of erm(B) induction by erythromycin. (PMID 18299414)

Yu L, et al. 1997. Nat Struct Biol 4(6): 483-489. Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance. (PMID 9187657)

Hajduk PJ, et al. 1999. J Med Chem 42(19): 3852-3859. Novel inhibitors of Erm methyltransferases from NMR and parallel synthesis. (PMID 10508434)

Resistomes

Prevalence of ErmB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0.06%0.03%0%
Acinetobacter towneri0%18.75%0%0%
Anaerostipes hadrus66.67%0%1.82%0%
Bacillus subtilis0.9%0%0.65%0%
Bacillus thuringiensis0%0%0.16%0%
Bacteroides caccae0%0%1.43%0%
Bacteroides fragilis4.17%0%2.5%0%
Bacteroides ovatus0%0%5.34%0%
Bacteroides thetaiotaomicron0%0%3.23%0%
Bifidobacterium breve0%0%0.89%0%
Butyricimonas faecalis100%0%0%0%
Campylobacter coli16.39%0%2.25%0%
Campylobacter jejuni0.4%0%0.25%0%
Citrobacter amalonaticus0%9.09%0%0%
Citrobacter freundii0%0%0.24%0%
Clostridium perfringens1.75%0%1.51%0%
Collinsella aerofaciens0%0%4.11%0%
Eggerthella lenta10%0%2.86%0%
Enterobacter chengduensis0%0%4.76%0%
Enterobacter hormaechei0%0%0.05%0%
Enterocloster clostridioformis0%0%11.43%0%
Enterococcus avium0%33.33%16.22%0%
Enterococcus faecalis18.29%26.82%27.09%0%
Enterococcus faecium1.8%15.81%39.41%0%
Enterococcus hirae4.76%22.58%11.17%0%
Erysipelatoclostridium ramosum0%0%7.69%0%
Escherichia coli0.4%0.75%1.91%0%
Eubacterium maltosivorans100%0%0%0%
Faecalibacterium prausnitzii35.71%0%24.18%0%
Fusobacterium nucleatum7.69%0%0%0%
Gemella morbillorum33.33%0%100%0%
Jeotgalibaca arthritidis100%0%0%0%
Klebsiella oxytoca0%0.82%0%0%
Klebsiella pneumoniae0%0.56%1.29%0%
Klebsiella quasipneumoniae0%0%0.16%0%
Lactobacillus crispatus11.11%0%0.38%0%
Lactobacillus iners28.57%0%3.28%0%
Lactobacillus johnsonii27.78%0%7.14%0%
Lactococcus garvieae0%9.09%0%0%
Listeria innocua0%12.5%0%0%
Listeria monocytogenes0%0%0.03%0%
Megasphaera stantonii0%0%50%0%
Phocaeicola dorei11.11%0%15.91%0%
Phocaeicola massiliensis0%0%5.88%0%
Phocaeicola vulgatus0%0%3.86%0%
Pseudomonas aeruginosa0%0%0.03%0%
Salmonella enterica0.07%0.34%0.08%0%
Shigella boydii0%0%3.3%0%
Shigella flexneri0%4%8.61%0%
Shigella sonnei0%5%1.41%0%
Staphylococcus arlettae0%0%2.5%0%
Staphylococcus aureus2.92%0.47%1.93%0%
Staphylococcus epidermidis0%0%0.28%0%
Staphylococcus haemolyticus0%0%0.22%0%
Staphylococcus pseudintermedius39.62%0%53.97%0%
Staphylococcus saprophyticus0%0%1.5%0%
Staphylococcus warneri0%0%1.75%0%
Streptococcus agalactiae14.58%0%14.52%0%
Streptococcus anginosus8.33%0%8.33%0%
Streptococcus canis0%0%14.29%0%
Streptococcus cristatus50%0%18.18%0%
Streptococcus dysgalactiae2.56%0%6.19%0%
Streptococcus equi0%0%0.68%0%
Streptococcus gallolyticus0%0%35%0%
Streptococcus gordonii7.69%0%2.82%0%
Streptococcus gwangjuense100%0%0%0%
Streptococcus iniae0%100%2.33%0%
Streptococcus intermedius14.29%0%15.91%0%
Streptococcus lutetiensis14.29%0%2.5%0%
Streptococcus mitis0%0%5.81%0%
Streptococcus mutans0%33.33%0.42%0%
Streptococcus pasteurianus50%0%42.86%0%
Streptococcus pneumoniae20.51%0%11.68%0%
Streptococcus porcinus0%0%33.33%0%
Streptococcus pseudopneumoniae100%0%11.11%0%
Streptococcus pyogenes5.1%0%1.5%0%
Streptococcus sanguinis0%0%6.02%0%
Streptococcus suis54.55%0%43.97%0%
Treponema denticola0%0%11.76%0%
Vibrio parahaemolyticus0%0%0.12%0%
Vibrio vulnificus0%0%0.81%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAF86219.1|+|ErmB [Enterococcus faecium]
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFP
NKQRYKIVGSIPYNLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTT
DVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRKLIL


>gb|AF242872.1|+|2132-2878|ErmB [Enterococcus faecium]
ATGAACAAAAATATAAAATATTCTCAAAACTTTTTAACGAGTGAAAAAGTACTCAACCAAATAATAAAACAATTGAATTTAAAAGAAACC
GATACCGTTTACGAAATTGGAACAGGTAAAGGGCATTTAACGACGAAACTGGCTAAAATAAGTAAACAGGTAACGTCTATTGAATTAGAC
AGTCATCTATTCAACTTATCGTCAGAAAAATTAAAACTGAATACTCGTGTCACTTTAATTCACCAAGATATTCTACAGTTTCAATTCCCT
AACAAACAGAGGTATAAAATTGTTGGGAGTATTCCTTACAATTTAAGCACACAAATTATTAAAAAAGTGGTTTTTGAAAGCCGTGCGTCT
GACATCTATCTGATTGTTGAAGAAGGATTCTACAAGCGTACCTTGGATATTCACCGAACACTAGGGTTGCTCTTGCACACTCAAGTCTCG
ATTCAGCAATTGCTTAAGCTGCCAGCGGAATGCTTTCATCCTAAACCAAAAGTAAACAGTGTCTTAATAAAACTTACCCGCCATACCACA
GATGTTCCAGATAAATATTGGAAGCTATATACGTACTTTGTTTCAAAATGGGTCAATCGAGAATATCGTCAACTGTTTACTAAAAATCAG
TTTCATCAAGCAATGAAACACGCCAAAGTAAACAATTTAAGTACCATTACTTATGAGCAAGTATTGTCTATTTTTAATAGTTATCTATTA
TTTAACGGGAGGAAATTAATTCTATGA