Klebsiella mutant PhoP conferring antibiotic resistance to colistin

Accession ARO:3003585
DefinitionA mutant phoP activates pmrHFIJKLM expression responsible for L-aminoarabinose synthesis and polymyxin resistance, by way of alteration of negative charge
AMR Gene Familypmr phosphoethanolamine transferase, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, pleuromutilin antibiotic, cephalosporin, acridine dye, penam, macrolide antibiotic, nitroimidazole antibiotic, fluoroquinolone antibiotic, rifamycin antibiotic, tetracycline antibiotic
Resistance Mechanismantibiotic target alteration, antibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Classification38 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ antibiotic resistant gene variant or mutant
+ confers_resistance_to_antibiotic colistin A [Antibiotic]
+ confers_resistance_to_antibiotic colistin B [Antibiotic]
+ phoP
+ gene altering cell wall charge
Publications

Jayol A, et al. 2015. Antimicrob Agents Chemother 59(5): 2780-2784. Heteroresistance to Colistin in Klebsiella pneumoniae Associated with Alterations in the PhoPQ Regulatory System. (PMID 25733503)

Resistomes

Prevalence of Klebsiella mutant PhoP conferring antibiotic resistance to colistin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 400


>gb|CDO13981.1|-|Klebsiella mutant PhoP conferring antibiotic resistance to colistin [Klebsiella pneumoniae]
MRVLVVEDNALLRHHLKVQLQELGHQVDAAEDAREADYYLGEHLPDIAIVDLGLPDEDGL
SLIRRWRSHDVSLPVLVLTAREGWQDKVEVLSAGADDYVTKPFHIEEVAARMQALLRRNS
GLASQVISLPPFQVDLSRRELSVNDQPIKLTAFEYTIMETLIRNRGKVVSKDSLMLQLYP
DAELRESHTIDVLMGRLRKKIQAEYPQDVITTVRGQGYLFELR



>gb|FO834906.1|-|2325637-2326308|Klebsiella mutant PhoP conferring antibiotic resistance to colistin [Klebsiella pneumoniae]
ATGCGCGTACTCGTGGTTGAGGATAATGCCCTGCTGCGTCACCACCTCAAAGTTCAGCTGCAGGAGCTGGGCCATCAGGTCGATGCGGCG
GAAGATGCCAGGGAAGCGGACTACTATCTGGGCGAACATCTCCCGGATATCGCCATCGTCGATCTCGGCCTGCCGGATGAAGACGGTTTA
TCACTGATCCGCCGCTGGCGCAGCCACGACGTGTCGCTGCCGGTGCTGGTGCTGACCGCCCGCGAAGGATGGCAGGATAAAGTGGAAGTG
CTGAGCGCCGGGGCGGATGATTACGTCACCAAGCCTTTCCATATTGAAGAGGTTGCCGCCCGCATGCAGGCGCTGCTGCGCCGTAACAGC
GGTCTGGCCTCGCAGGTGATCTCCCTGCCGCCGTTCCAGGTCGACCTCTCCCGGCGCGAGCTGTCGGTGAATGACCAGCCGATCAAGCTG
ACCGCCTTTGAATACACCATTATGGAAACCCTGATCCGTAACCGCGGCAAAGTGGTCAGCAAAGATTCGCTGATGCTCCAGCTTTACCCG
GATGCCGAACTGCGAGAAAGCCACACCATCGACGTGCTGATGGGTCGGCTGCGCAAGAAAATTCAGGCTGAATACCCACAGGACGTCATC
ACCACGGTGCGCGGCCAGGGCTATCTGTTCGAATTGCGCTGA