Pseudomonas mutant PhoP conferring resistance to colistin

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003895
CARD Short NamePaer_PhoP_CST
DefinitionMutations in Pseudomonas aeruginosa PhoP of the two-component PhoPQ regulatory system. Presence of mutation confers resistance to colistin.
AMR Gene Familypmr phosphoethanolamine transferase, antibiotic efflux regulatory protein, transmembrane protein conferring colistin resistance, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, macrolide antibiotic
Resistance Mechanismantibiotic target alteration, resistance by absence, antibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification36 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic colistin A [Antibiotic]
+ confers_resistance_to_antibiotic colistin B [Antibiotic]
+ phoP
Resistomes with Sequence VariantsPseudomonas aeruginosawgs
Publications

Lee JY, et al. 2014. Diagn Microbiol Infect Dis 78(3): 271-276. Mutations and expression of PmrAB and PhoPQ related with colistin resistance in Pseudomonas aeruginosa clinical isolates. (PMID 24412662)

Resistomes

Prevalence of Pseudomonas mutant PhoP conferring resistance to colistin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa0%0%0.03%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 400

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
A110Vsingle resistance variantPMID:24412662
R117Lsingle resistance variantPMID:24412662

>gb|AAG04568.1|+|Pseudomonas mutant PhoP conferring resistance to colistin [Pseudomonas aeruginosa PAO1]
MKLLVVEDEALLRHHLYTRLGEQGHVVDAVPDAEEALYRVSEYHHDLAVIDLGLPGMSGL
DLIRELRSQGKSFPILILTARGNWQDKVEGLAAGADDYVVKPFQFEELEARLNALLRRSS
GFVQSTIEAGPLVLDLNRKQALVEEQPVALTAYEYRILEYLMRHHQQVVAKERLMEQLYP
DDEERDANVIEVLVGRLRRKLEACGGFKPIDTVRGQGYLFTERCR



>gb|AE004091.2|+|1277688-1278365|Pseudomonas mutant PhoP conferring resistance to colistin [Pseudomonas aeruginosa PAO1]
ATGAAACTGCTGGTAGTGGAAGACGAGGCGCTGTTGCGCCACCACCTCTATACCCGCCTGGGTGAACAGGGGCACGTGGTGGACGCGGTA
CCGGATGCCGAGGAAGCCCTCTACCGGGTCAGCGAATACCACCACGACCTGGCGGTGATCGACCTCGGCCTGCCGGGCATGAGCGGCCTG
GACCTGATCCGCGAGCTGCGTTCGCAGGGCAAGTCCTTCCCGATCCTGATCCTCACCGCCCGCGGCAACTGGCAGGACAAGGTCGAAGGC
CTGGCCGCCGGGGCCGACGACTACGTGGTCAAGCCGTTCCAGTTCGAGGAACTGGAAGCGCGCCTGAACGCGTTGCTGCGACGCTCCTCG
GGGTTCGTCCAGTCGACCATCGAGGCCGGCCCCCTGGTCCTCGACCTGAACCGCAAGCAGGCGCTGGTCGAGGAGCAACCGGTGGCGCTG
ACCGCCTACGAATACCGCATCCTCGAATACCTCATGCGGCATCACCAGCAGGTGGTGGCCAAGGAACGCCTGATGGAACAGCTCTATCCC
GACGACGAGGAGCGCGACGCCAACGTCATCGAGGTGCTGGTCGGCCGCCTGCGGCGCAAGCTGGAGGCCTGCGGCGGCTTCAAGCCGATC
GATACGGTGCGCGGCCAGGGCTACCTGTTCACCGAGCGCTGCCGGTGA

Curator Acknowledgements
Curator Description Most Recent Edit