Accession ARO:3000379
DefinitionOprM is an outer membrane factor protein found in Pseudomonas aeruginosa and Burkholderia vietnamiensis. It is part of the MexAB-OprM, MexVW-OprM, MexXY-OprM and the AmrAB-OprM complex.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpeptide antibiotic, sulfonamide antibiotic, penam, tetracycline antibiotic, diaminopyrimidine antibiotic, triclosan, carbapenem, glycylcycline, aminocoumarin antibiotic, acridine dye, monobactam, macrolide antibiotic, aminoglycoside antibiotic, fluoroquinolone antibiotic, cephalosporin, phenicol antibiotic, antibacterial free fatty acids, penem, cephamycin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesPseudomonas fluorescensg
Classification65 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ beta-lactam antibiotic
+ mechanism of antibiotic resistance
+ lipopeptide antibiotic
+ resistance-modifying agents
+ polymyxin antibiotic
+ determinant of antibiotic resistance
+ sulfonamide antibiotic [Drug Class]
+ penam [Drug Class]
+ antibiotic without defined classification
+ cephem
+ antibiotic efflux [Resistance Mechanism]
+ tetracycline antibiotic [Drug Class]
+ beta-lactamase inhibitor
+ diaminopyrimidine antibiotic [Drug Class]
+ amoxicillin [Antibiotic]
+ sulfamethoxazole [Antibiotic]
+ triclosan [Drug Class]
+ antibiotic mixture
+ colistin
+ carbapenem [Drug Class]
+ glycylcycline [Drug Class]
+ aminocoumarin antibiotic [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ acridine dye [Drug Class]
+ monobactam [Drug Class]
+ trimethoprim [Antibiotic]
+ macrolide antibiotic [Drug Class]
+ aminoglycoside antibiotic [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ cephalosporin [Drug Class]
+ phenicol antibiotic [Drug Class]
+ clavulanic acid [Adjuvant]
+ antibacterial free fatty acids [Drug Class]
+ ceftriaxone [Antibiotic]
+ azithromycin [Antibiotic]
+ erythromycin [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ aztreonam [Antibiotic]
+ colistin B [Antibiotic]
+ panipenem [Antibiotic]
+ penem [Drug Class]
+ amoxicillin-clavulanic acid
+ cephamycin [Drug Class]
+ colistin A [Antibiotic]
+ novobiocin [Antibiotic]
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ meropenem [Antibiotic]
+ ceftazidime [Antibiotic]
+ ampicillin [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ tetracycline [Antibiotic]
+ chloramphenicol [Antibiotic]
+ nalidixic acid [Antibiotic]
+ ticarcillin [Antibiotic]
+ MexAB-OprM
+ gentamicin C [Antibiotic]
+ acriflavine [Antibiotic]
+ tobramycin [Antibiotic]
+ norfloxacin [Antibiotic]
+ ofloxacin [Antibiotic]
+ amikacin [Antibiotic]
+ thiamphenicol [Antibiotic]
Parent Term(s)12 ontology terms | Show
Publications

Lambert O, et al. 2005. J Struct Biol 150(1): 50-57. Trimeric structure of OprN and OprM efflux proteins from Pseudomonas aeruginosa, by 2D electron crystallography. (PMID 15797729)

Akama H, et al. 2005. Acta Crystallogr Sect F Struct Biol Cryst Commun 61(PT 1): 131-133. Preliminary crystallographic analysis of the antibiotic discharge outer membrane lipoprotein OprM of Pseudomonas aeruginosa with an exceptionally long unit cell and complex lattice structure. (PMID 16508113)

Broutin I, et al. 2005. Acta Crystallogr Sect F Struct Biol Cryst Commun 61(PT 3): 315-318. Expression, purification, crystallization and preliminary X-ray studies of the outer membrane efflux proteins OprM and OprN from Pseudomonas aeruginosa. (PMID 16511029)

Resistomes

Prevalence of OprM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter cloacae0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 850


>gb|AAG03816.1|+|OprM [Pseudomonas aeruginosa PAO1]
MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAF
RAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVAT
AYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLD
QTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRAS
LDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRL
NQLTSEVNLYKALGGGWNQQTVTQQQTAKKEDPQA


>gb|AE004091.2|+|476333-477790|OprM [Pseudomonas aeruginosa PAO1]
ATGAAACGGTCCTTCCTTTCCCTGGCGGTAGCCGCTGTCGTTCTGTCCGGCTGCTCGCTGATCCCCGACTACCAGCGCCCCGAGGCGCCG
GTAGCCGCGGCCTACCCGCAAGGGCAGGCCTACGGGCAGAACACCGGCGCGGCGGCCGTTCCGGCCGCCGACATCGGCTGGCGCGAGTTC
TTCCGCGACCCGCAGTTGCAGCAACTGATCGGCGTGGCGCTGGAAAACAACCGCGACCTGCGGGTCGCCGCGCTGAACGTCGAGGCCTTC
CGGGCGCAGTACCGCATCCAGCGGGCCGACCTGTTCCCGCGGATCGGCGTGGACGGTAGCGGCACCCGCCAGCGTTTGCCGGGCGACCTG
TCGACCACCGGCAGTCCGGCGATTTCCAGCCAGTACGGGGTGACCCTGGGCACTACCGCCTGGGAACTCGATCTCTTCGGCCGCCTGCGC
AGCCTGCGCGACCAGGCCCTGGAGCAGTACCTGGCGACCGAACAGGCGCAGCGCAGCGCGCAGACCACCCTGGTGGCCAGCGTGGCGACC
GCCTACCTGACGCTGAAGGCCGACCAGGCGCAGTTGCAGCTGACCAAGGACACCCTGGGCACCTACCAGAAGAGTTTCGACCTGACCCAG
CGCAGCTACGACGTCGGCGTCGCCTCCGCGCTCGACCTGCGCCAGGCGCAGACCGCCGTGGAAGGCGCCCGCGCGACCCTGGCGCAGTAC
ACCCGCCTGGTAGCCCAGGACCAGAATGCGCTGGTCCTGCTGCTGGGCTCCGGGATCCCGGCGAACCTGCCGCAAGGCCTGGGCCTGGAC
CAGACCCTGCTGACCGAAGTGCCGGCGGGTCTGCCGTCGGACCTGCTGCAACGGCGCCCGGACATCCTCGAGGCCGAGCACCAGCTCATG
GCTGCCAACGCCAGCATCGGCGCCGCGCGCGCGGCGTTCTTCCCGAGCATCAGCCTGACCGCCAACGCCGGCACCATGAGCCGCCAACTG
TCCGGCCTGTTCGACGCCGGTTCGGGTTCCTGGTTGTTCCAGCCGTCGATCAACCTGCCGATCTTCACCGCCGGCAGCCTGCGTGCCAGC
CTGGACTACGCGAAGATCCAGAAGGACATCAACGTCGCGCAGTACGAGAAGGCGATCCAGACGGCGTTCCAGGAAGTCGCCGACGGCCTG
GCCGCGCGCGGTACCTTCACCGAGCAGTTGCAGGCGCAGCGCGATCTGGTCAAGGCCAGCGACGAGTACTACCAGCTCGCCGACAAGCGC
TATCGCACGGGGGTGGACAACTACCTGACCCTGCTCGACGCGCAACGCTCGCTGTTCACCGCGCAGCAGCAACTGATCACCGACCGCCTC
AATCAGCTGACCAGCGAGGTCAACCTGTACAAGGCCCTCGGCGGCGGCTGGAACCAGCAGACCGTGACCCAGCAGCAGACCGCGAAGAAG
GAAGATCCCCAGGCTTGA