Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000379
CARD Short NameOprM
DefinitionOprM is an outer membrane factor protein found in Pseudomonas aeruginosa and Burkholderia vietnamiensis. It is part of the MexAB-OprM, MexVW-OprM, MexXY-OprM and the AmrAB-OprM complex.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpeptide antibiotic, sulfonamide antibiotic, diaminopyrimidine antibiotic, penicillin beta-lactam, cephalosporin, aminoglycoside antibiotic, disinfecting agents and antiseptics, phenicol antibiotic, aminocoumarin antibiotic, tetracycline antibiotic, carbapenem, monobactam, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesPseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsPseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg
Classification53 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ lipopeptide antibiotic
+ beta-lactam antibiotic
+ mechanism of antibiotic resistance
+ antibiotic mixture
+ sulfonamide antibiotic [Drug Class]
+ diaminopyrimidine antibiotic [Drug Class]
+ penicillin beta-lactam [Drug Class]
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ cephalosporin [Drug Class]
+ polymyxin antibiotic
+ aminoglycoside antibiotic [Drug Class]
+ penicillin with extended spectrum
+ third-generation cephalosporin
+ gentamicin [Antibiotic]
+ disinfecting agents and antiseptics [Drug Class]
+ phenicol antibiotic [Drug Class]
+ sulfamethoxazole [Antibiotic]
+ trimethoprim [Antibiotic]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ aminocoumarin antibiotic [Drug Class]
+ tetracycline antibiotic [Drug Class]
+ colistin
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ macrolide antibiotic [Drug Class]
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ panipenem [Antibiotic]
+ ofloxacin [Antibiotic]
+ norfloxacin [Antibiotic]
+ ampicillin [Antibiotic]
+ colistin B [Antibiotic]
+ colistin A [Antibiotic]
+ aztreonam [Antibiotic]
+ thiamphenicol [Antibiotic]
+ chloramphenicol [Antibiotic]
+ azithromycin [Antibiotic]
+ novobiocin [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ meropenem [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftazidime [Antibiotic]
+ tobramycin [Antibiotic]
+ tetracycline [Antibiotic]
+ acriflavine [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ gentamicin C [Antibiotic]
+ amikacin [Antibiotic]
+ erythromycin [Antibiotic]
Parent Term(s)7 ontology terms | Show
+ outer_membrane_protein_of MexAB-OprM
+ subunit of efflux pump conferring antibiotic resistance
+ part_of AmrAB-OprM
+ part_of MexVW-OprM
+ part_of MexXY-OprM
+ part_of MexJK-OprM
+ part_of MexMN-OprM
Publications

Lambert O, et al. 2005. J Struct Biol 150(1): 50-57. Trimeric structure of OprN and OprM efflux proteins from Pseudomonas aeruginosa, by 2D electron crystallography. (PMID 15797729)

Akama H, et al. 2005. Acta Crystallogr Sect F Struct Biol Cryst Commun 61(PT 1): 131-133. Preliminary crystallographic analysis of the antibiotic discharge outer membrane lipoprotein OprM of Pseudomonas aeruginosa with an exceptionally long unit cell and complex lattice structure. (PMID 16508113)

Broutin I, et al. 2005. Acta Crystallogr Sect F Struct Biol Cryst Commun 61(PT 3): 315-318. Expression, purification, crystallization and preliminary X-ray studies of the outer membrane efflux proteins OprM and OprN from Pseudomonas aeruginosa. (PMID 16511029)

Resistomes

Prevalence of OprM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa98.47%0.58%96.38%0%0%
Pseudomonas fluorescens2.78%0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 850


>gb|AAG03816.1|+|OprM [Pseudomonas aeruginosa PAO1]
MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAF
RAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVAT
AYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLD
QTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRAS
LDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRL
NQLTSEVNLYKALGGGWNQQTVTQQQTAKKEDPQA


>gb|AE004091.2|+|476333-477790|OprM [Pseudomonas aeruginosa PAO1]
ATGAAACGGTCCTTCCTTTCCCTGGCGGTAGCCGCTGTCGTTCTGTCCGGCTGCTCGCTGATCCCCGACTACCAGCGCCCCGAGGCGCCG
GTAGCCGCGGCCTACCCGCAAGGGCAGGCCTACGGGCAGAACACCGGCGCGGCGGCCGTTCCGGCCGCCGACATCGGCTGGCGCGAGTTC
TTCCGCGACCCGCAGTTGCAGCAACTGATCGGCGTGGCGCTGGAAAACAACCGCGACCTGCGGGTCGCCGCGCTGAACGTCGAGGCCTTC
CGGGCGCAGTACCGCATCCAGCGGGCCGACCTGTTCCCGCGGATCGGCGTGGACGGTAGCGGCACCCGCCAGCGTTTGCCGGGCGACCTG
TCGACCACCGGCAGTCCGGCGATTTCCAGCCAGTACGGGGTGACCCTGGGCACTACCGCCTGGGAACTCGATCTCTTCGGCCGCCTGCGC
AGCCTGCGCGACCAGGCCCTGGAGCAGTACCTGGCGACCGAACAGGCGCAGCGCAGCGCGCAGACCACCCTGGTGGCCAGCGTGGCGACC
GCCTACCTGACGCTGAAGGCCGACCAGGCGCAGTTGCAGCTGACCAAGGACACCCTGGGCACCTACCAGAAGAGTTTCGACCTGACCCAG
CGCAGCTACGACGTCGGCGTCGCCTCCGCGCTCGACCTGCGCCAGGCGCAGACCGCCGTGGAAGGCGCCCGCGCGACCCTGGCGCAGTAC
ACCCGCCTGGTAGCCCAGGACCAGAATGCGCTGGTCCTGCTGCTGGGCTCCGGGATCCCGGCGAACCTGCCGCAAGGCCTGGGCCTGGAC
CAGACCCTGCTGACCGAAGTGCCGGCGGGTCTGCCGTCGGACCTGCTGCAACGGCGCCCGGACATCCTCGAGGCCGAGCACCAGCTCATG
GCTGCCAACGCCAGCATCGGCGCCGCGCGCGCGGCGTTCTTCCCGAGCATCAGCCTGACCGCCAACGCCGGCACCATGAGCCGCCAACTG
TCCGGCCTGTTCGACGCCGGTTCGGGTTCCTGGTTGTTCCAGCCGTCGATCAACCTGCCGATCTTCACCGCCGGCAGCCTGCGTGCCAGC
CTGGACTACGCGAAGATCCAGAAGGACATCAACGTCGCGCAGTACGAGAAGGCGATCCAGACGGCGTTCCAGGAAGTCGCCGACGGCCTG
GCCGCGCGCGGTACCTTCACCGAGCAGTTGCAGGCGCAGCGCGATCTGGTCAAGGCCAGCGACGAGTACTACCAGCTCGCCGACAAGCGC
TATCGCACGGGGGTGGACAACTACCTGACCCTGCTCGACGCGCAACGCTCGCTGTTCACCGCGCAGCAGCAACTGATCACCGACCGCCTC
AATCAGCTGACCAGCGAGGTCAACCTGTACAAGGCCCTCGGCGGCGGCTGGAACCAGCAGACCGTGACCCAGCAGCAGACCGCGAAGAAG
GAAGATCCCCAGGCTTGA

Curator Acknowledgements
Curator Description Most Recent Edit