Accession ARO:3000379
CARD Short NameOprM
DefinitionOprM is an outer membrane factor protein found in Pseudomonas aeruginosa and Burkholderia vietnamiensis. It is part of the MexAB-OprM, MexVW-OprM, MexXY-OprM and the AmrAB-OprM complex.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpeptide antibiotic, penam, diaminopyrimidine antibiotic, sulfonamide antibiotic, cephalosporin, carbapenem, macrolide antibiotic, tetracycline antibiotic, monobactam, phenicol antibiotic, aminocoumarin antibiotic, fluoroquinolone antibiotic, cephamycin, penem, disinfecting agents and antiseptics, aminoglycoside antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesPseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Burkholderia multivoranswgs, Enterobacter cloacaewgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg, Stenotrophomonas maltophiliawgs
Classification63 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ resistance-modifying agents
+ beta-lactamase inhibitor
+ peptide antibiotic [Drug Class]
+ lipopeptide antibiotic
+ beta-lactam antibiotic
+ serine beta-lactamase inhibitor
+ mechanism of antibiotic resistance
+ polymyxin antibiotic
+ cephem
+ penam [Drug Class]
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ diaminopyrimidine antibiotic [Drug Class]
+ sulfonamide antibiotic [Drug Class]
+ beta-lactam derived beta-lactamase inhibitor
+ sulfamethoxazole [Antibiotic]
+ amoxicillin [Antibiotic]
+ cephalosporin [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ colistin
+ antibiotic mixture
+ carbapenem [Drug Class]
+ macrolide antibiotic [Drug Class]
+ tetracycline antibiotic [Drug Class]
+ monobactam [Drug Class]
+ phenicol antibiotic [Drug Class]
+ aminocoumarin antibiotic [Drug Class]
+ trimethoprim [Antibiotic]
+ clavulanic acid [Adjuvant]
+ fluoroquinolone antibiotic [Drug Class]
+ ciprofloxacin [Antibiotic]
+ colistin A [Antibiotic]
+ amoxicillin-clavulanic acid [Antibiotic+Adjuvant]
+ ceftriaxone [Antibiotic]
+ cephamycin [Drug Class]
+ novobiocin [Antibiotic]
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ colistin B [Antibiotic]
+ tetracycline [Antibiotic]
+ ceftazidime [Antibiotic]
+ azithromycin [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ aztreonam [Antibiotic]
+ penem [Drug Class]
+ chloramphenicol [Antibiotic]
+ erythromycin [Antibiotic]
+ panipenem [Antibiotic]
+ meropenem [Antibiotic]
+ disinfecting agents and antiseptics [Drug Class]
+ ampicillin [Antibiotic]
+ aminoglycoside antibiotic [Drug Class]
+ nalidixic acid [Antibiotic]
+ ticarcillin [Antibiotic]
+ MexAB-OprM
+ amikacin [Antibiotic]
+ thiamphenicol [Antibiotic]
+ norfloxacin [Antibiotic]
+ tobramycin [Antibiotic]
+ gentamicin C [Antibiotic]
+ ofloxacin [Antibiotic]
+ acriflavine [Antibiotic]
Parent Term(s)12 ontology terms | Show
Publications

Lambert O, et al. 2005. J Struct Biol 150(1): 50-57. Trimeric structure of OprN and OprM efflux proteins from Pseudomonas aeruginosa, by 2D electron crystallography. (PMID 15797729)

Akama H, et al. 2005. Acta Crystallogr Sect F Struct Biol Cryst Commun 61(PT 1): 131-133. Preliminary crystallographic analysis of the antibiotic discharge outer membrane lipoprotein OprM of Pseudomonas aeruginosa with an exceptionally long unit cell and complex lattice structure. (PMID 16508113)

Broutin I, et al. 2005. Acta Crystallogr Sect F Struct Biol Cryst Commun 61(PT 3): 315-318. Expression, purification, crystallization and preliminary X-ray studies of the outer membrane efflux proteins OprM and OprN from Pseudomonas aeruginosa. (PMID 16511029)

Resistomes

Prevalence of OprM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.02%0%
Burkholderia multivorans0%0%0.32%0%
Enterobacter cloacae0%0%0.36%0%
Escherichia coli0%0%0.01%0%
Klebsiella pneumoniae0%0%0.01%0%
Pseudomonas aeruginosa100%0.64%74.9%0%
Pseudomonas fluorescens2.86%0%0%0%
Stenotrophomonas maltophilia0%0%0.34%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 850


>gb|AAG03816.1|+|OprM [Pseudomonas aeruginosa PAO1]
MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAF
RAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVAT
AYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLD
QTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRAS
LDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRL
NQLTSEVNLYKALGGGWNQQTVTQQQTAKKEDPQA


>gb|AE004091.2|+|476333-477790|OprM [Pseudomonas aeruginosa PAO1]
ATGAAACGGTCCTTCCTTTCCCTGGCGGTAGCCGCTGTCGTTCTGTCCGGCTGCTCGCTGATCCCCGACTACCAGCGCCCCGAGGCGCCG
GTAGCCGCGGCCTACCCGCAAGGGCAGGCCTACGGGCAGAACACCGGCGCGGCGGCCGTTCCGGCCGCCGACATCGGCTGGCGCGAGTTC
TTCCGCGACCCGCAGTTGCAGCAACTGATCGGCGTGGCGCTGGAAAACAACCGCGACCTGCGGGTCGCCGCGCTGAACGTCGAGGCCTTC
CGGGCGCAGTACCGCATCCAGCGGGCCGACCTGTTCCCGCGGATCGGCGTGGACGGTAGCGGCACCCGCCAGCGTTTGCCGGGCGACCTG
TCGACCACCGGCAGTCCGGCGATTTCCAGCCAGTACGGGGTGACCCTGGGCACTACCGCCTGGGAACTCGATCTCTTCGGCCGCCTGCGC
AGCCTGCGCGACCAGGCCCTGGAGCAGTACCTGGCGACCGAACAGGCGCAGCGCAGCGCGCAGACCACCCTGGTGGCCAGCGTGGCGACC
GCCTACCTGACGCTGAAGGCCGACCAGGCGCAGTTGCAGCTGACCAAGGACACCCTGGGCACCTACCAGAAGAGTTTCGACCTGACCCAG
CGCAGCTACGACGTCGGCGTCGCCTCCGCGCTCGACCTGCGCCAGGCGCAGACCGCCGTGGAAGGCGCCCGCGCGACCCTGGCGCAGTAC
ACCCGCCTGGTAGCCCAGGACCAGAATGCGCTGGTCCTGCTGCTGGGCTCCGGGATCCCGGCGAACCTGCCGCAAGGCCTGGGCCTGGAC
CAGACCCTGCTGACCGAAGTGCCGGCGGGTCTGCCGTCGGACCTGCTGCAACGGCGCCCGGACATCCTCGAGGCCGAGCACCAGCTCATG
GCTGCCAACGCCAGCATCGGCGCCGCGCGCGCGGCGTTCTTCCCGAGCATCAGCCTGACCGCCAACGCCGGCACCATGAGCCGCCAACTG
TCCGGCCTGTTCGACGCCGGTTCGGGTTCCTGGTTGTTCCAGCCGTCGATCAACCTGCCGATCTTCACCGCCGGCAGCCTGCGTGCCAGC
CTGGACTACGCGAAGATCCAGAAGGACATCAACGTCGCGCAGTACGAGAAGGCGATCCAGACGGCGTTCCAGGAAGTCGCCGACGGCCTG
GCCGCGCGCGGTACCTTCACCGAGCAGTTGCAGGCGCAGCGCGATCTGGTCAAGGCCAGCGACGAGTACTACCAGCTCGCCGACAAGCGC
TATCGCACGGGGGTGGACAACTACCTGACCCTGCTCGACGCGCAACGCTCGCTGTTCACCGCGCAGCAGCAACTGATCACCGACCGCCTC
AATCAGCTGACCAGCGAGGTCAACCTGTACAAGGCCCTCGGCGGCGGCTGGAACCAGCAGACCGTGACCCAGCAGCAGACCGCGAAGAAG
GAAGATCCCCAGGCTTGA