Escherichia coli soxR with mutation conferring antibiotic resistance

Accession ARO:3003381
CARD Short NameEcol_soxR_MULT
DefinitionSoxR is a sensory protein that upregulates soxS expression in the presence of redox-cycling drugs. This stress response leads to the expression many multidrug efflux pumps.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, major facilitator superfamily (MFS) antibiotic efflux pump, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella oxytocap, Salmonella bongorig+wgs, Salmonella entericag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Classification38 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic nalidixic acid [Antibiotic]
+ soxR
Publications

Gu M and Imlay JA. 2011. Mol Microbiol 79(5): 1136-1150. The SoxRS response of Escherichia coli is directly activated by redox-cycling drugs rather than by superoxide. (PMID 21226770)

Koutsolioutsou A, et al. 2005. Antimicrob. Agents Chemother. 49(7):2746-52 Constitutive soxR mutations contribute to multiple-antibiotic resistance in clinical Escherichia coli isolates. (PMID 15980345)

Webber MA, et al. 2001. Antimicrob. Agents Chemother. 45(5):1550-2 Absence of mutations in marRAB or soxRS in acrB-overexpressing fluoroquinolone-resistant clinical and veterinary isolates of Escherichia coli. (PMID 11302826)

Resistomes

Prevalence of Escherichia coli soxR with mutation conferring antibiotic resistance among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein overexpression model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus90.91%0%96.36%0%0%
Escherichia albertii100%0%100%0%0%
Escherichia coli67.77%0.02%99.26%0%99.78%
Escherichia fergusonii100%0%100%0%0%
Escherichia marmotae100%0%97.92%0%0%
Klebsiella oxytoca0%0.68%0%0%0%
Salmonella bongori100%0%100%0%0%
Salmonella enterica91.99%0%97.42%0%0%
Shigella boydii86.67%0%96.67%0%0%
Shigella dysenteriae100%0%100%0%0%
Shigella flexneri99%0%99.69%0%0%
Shigella sonnei2.44%0%4.89%0%0%
Show Perfect Only


Detection Models

Model Type: protein overexpression model

Model Definition: Protein Overexpression Models (POM) are similar to Protein Variant Models (PVM) in that they include a protein reference sequence, a curated BLASTP bitscore cut-off, and mapped resistance variants. Whereas PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, reporting only those with curated mutations conferring AMR, POMs are restricted to regulatory proteins and report both wild-type sequences and/or sequences with mutations leading to overexpression of efflux complexes. The former lead to efflux of antibiotics at basal levels, while the latter can confer clinical resistance. POMs include a protein reference sequence (often from wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Perfect RGI match is 100% identical to the wild-type reference protein sequence along its entire length, a Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value may or may not contain at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off may or may not contain at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 300

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
R20Hsingle resistance variantPMID:15980345
S31Asingle resistance variantPMID:11302826
T38S,G74Rmultiple resistance variantsPMID:15980345
R71Ssingle resistance variantPMID:11302826
R90Gsingle resistance variantPMID:11302826
G121Dsingle resistance variantPMID:21226770
-S128deletion mutation from peptide sequencePMID:15980345
L148fsframeshift mutationPMID:15980345

>gb|AAC77033.1|+|Escherichia coli soxR with mutation conferring antibiotic resistance [Escherichia coli str. K-12 substr. MG1655]
MEKKLPRIKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAII
KIAQRIGIPLATIGEAFGVLPEGHTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCI
GCGCLSRSDCPLRNPGDRLGEEGTGARLLEDEQN



>gb|U00096.1|+|4277469-4277933|Escherichia coli soxR with mutation conferring antibiotic resistance [Escherichia coli str. K-12 substr. MG1655]
ATGGAAAAGAAATTACCCCGCATTAAAGCGCTGCTAACCCCCGGCGAAGTGGCGAAACGCAGCGGTGTGGCGGTATCGGCGCTGCATTTC
TATGAAAGTAAAGGGTTGATTACCAGTATCCGTAACAGCGGCAATCAGCGGCGATATAAACGTGATGTGTTGCGATATGTTGCAATTATC
AAAATTGCTCAGCGTATTGGCATTCCGCTGGCGACCATTGGTGAAGCGTTTGGCGTGTTGCCCGAAGGGCATACGTTAAGTGCGAAAGAG
TGGAAACAGCTTTCGTCCCAATGGCGAGAAGAGTTGGATCGGCGCATTCATACCTTAGTGGCGCTGCGTGACGAACTGGACGGATGTATT
GGTTGTGGCTGCCTTTCGCGCAGTGATTGCCCGTTGCGTAACCCGGGCGACCGCTTAGGAGAAGAAGGTACCGGCGCACGCTTGCTGGAA
GATGAACAAAACTAA

Curator Acknowledgements
Curator Description Most Recent Edit