Pseudomonas aeruginosa soxR

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004107
CARD Short NamePaer_soxR
DefinitionSoxR is a redox-sensitive transcriptional activator that induces expression of a small regulon that includes the RND efflux pump-encoding operon mexGHI-opmD. SoxR was shown to be activated by pyocyanin.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, major facilitator superfamily (MFS) antibiotic efflux pump, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Perfect MatchesPseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsPseudomonas aeruginosag+p+wgs, Pseudomonas brassicacearumg+wgs, Pseudomonas chlororaphisg+wgs, Pseudomonas fluorescensg+wgs, Pseudomonas koreensisg+wgs, Pseudomonas mendocinag+wgs, Pseudomonas monteiliiwgs, Pseudomonas putidag+wgs, Pseudomonas synxanthag+wgs, Pseudomonas syringaeg+wgs, Rhizobium leguminosarumg+wgs
Classification39 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ beta-lactam antibiotic
+ mechanism of antibiotic resistance
+ tetracycline antibiotic [Drug Class]
+ penicillin beta-lactam [Drug Class]
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ cephalosporin [Drug Class]
+ penicillin with extended spectrum
+ first-generation cephalosporin
+ disinfecting agents and antiseptics [Drug Class]
+ phenicol antibiotic [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ rifamycin antibiotic [Drug Class]
+ antibiotic target alteration [Resistance Mechanism]
+ glycylcycline [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ triclosan [Antibiotic]
+ cefalotin [Antibiotic]
+ norfloxacin [Antibiotic]
+ ampicillin [Antibiotic]
+ chloramphenicol [Antibiotic]
+ mutation conferring antibiotic resistance
+ rifampin [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ ATP-binding cassette (ABC) antibiotic efflux pump [AMR Gene Family]
+ tetracycline [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ tigecycline [Antibiotic]
+ PatA-PatB
+ protein(s) and two-component regulatory system modulating antibiotic efflux [Efflux Regulator]
+ QepA1
+ AcrAB-TolC
+ antibiotic resistant gene variant or mutant
+ soxRS
+ mutant efflux regulatory protein conferring antibiotic resistance
+ acriflavine [Antibiotic]
Parent Term(s)2 ontology terms | Show
+ positively_regulates MexGHI-OpmD
+ soxR
Publications

Sakhtah H, et al. 2016. Proc. Natl. Acad. Sci. U.S.A. 113(25):E3538-47 The Pseudomonas aeruginosa efflux pump MexGHI-OpmD transports a natural phenazine that controls gene expression and biofilm development. (PMID 27274079)

Palma M, et al. 2005. Infect Immun 73(5): 2958-2966. Pseudomonas aeruginosa SoxR does not conform to the archetypal paradigm for SoxR-dependent regulation of the bacterial oxidative stress adaptive response. (PMID 15845502)

Dietrich LE, et al. 2006. Mol. Microbiol. 61(5):1308-21 The phenazine pyocyanin is a terminal signalling factor in the quorum sensing network of Pseudomonas aeruginosa. (PMID 16879411)

Resistomes

Prevalence of Pseudomonas aeruginosa soxR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa96.17%0.58%96.61%0%0%
Pseudomonas brassicacearum100%0%64%0%0%
Pseudomonas chlororaphis100%0%83.87%0%0%
Pseudomonas fluorescens83.33%0%72.17%0%0%
Pseudomonas koreensis75%0%69.57%0%0%
Pseudomonas mendocina25%0%21.43%0%0%
Pseudomonas monteilii0%0%4.76%0%0%
Pseudomonas putida8.45%0%12.3%0%0%
Pseudomonas synxantha100%0%100%0%0%
Pseudomonas syringae2.08%0%2.71%0%0%
Rhizobium leguminosarum10%0%14.29%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|AAG05661.1|-|Pseudomonas aeruginosa soxR [Pseudomonas aeruginosa PAO1]
MKNSCASRELSVGELARRAGVAVSALHFYETKGLISSQRNAGNQRRFSRETLRRVVVIKVAQRVGIPLAEIARALQTLPAGRSPSAADWA
RLSAQWKEDLTERIDKLLLLRDQLDGCIGCGCLSLQACPLRNPGDQLSAEGPGAHWLDAEGREHDG


>gb|AE004091.2|-|2503425-2503895|Pseudomonas aeruginosa soxR [Pseudomonas aeruginosa PAO1]
ATGAAGAATTCCTGCGCATCTCGTGAACTGAGCGTCGGCGAACTGGCCAGGCGTGCCGGCGTGGCGGTCTCCGCCCTGCATTTCTACGAA
ACCAAGGGGCTGATCAGCAGCCAGCGCAACGCCGGCAACCAGCGGCGCTTCAGTCGCGAGACGCTACGCCGGGTGGTGGTGATCAAGGTC
GCCCAGCGGGTCGGCATTCCCCTCGCGGAGATCGCTCGCGCCCTGCAGACCCTGCCGGCGGGGCGCAGCCCTAGCGCGGCGGACTGGGCG
CGCCTGTCGGCGCAGTGGAAGGAGGATCTCACCGAGCGCATCGACAAGCTGCTGCTGTTGCGCGACCAACTGGACGGCTGCATCGGTTGC
GGCTGCCTGTCGCTCCAGGCCTGCCCGTTGCGCAACCCCGGCGACCAGCTTTCCGCCGAGGGGCCGGGAGCGCACTGGCTGGACGCCGAG
GGCCGCGAGCACGACGGCTAG

Curator Acknowledgements
Curator Description Most Recent Edit