Klebsiella pneumoniae KpnG

Accession ARO:3004588
Synonym(s)C8T8U1
DefinitionKpnG consists of ~390 residues and resembles EmrA of E. coli. Disruption of the pump components KpnG-KpnH signficantly decrease resistance to azithromycin, ceftazidime, ciprofloxacin, ertapenem, erythromycin, gentamicin, imipenem, ticarcillin, norfloxacin, polymyxin-B, piperacillin, spectinomycin, tobramycin, and streptomycin
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classpeptide antibiotic, penam, carbapenem, aminoglycoside antibiotic, cephalosporin, fluoroquinolone antibiotic, macrolide antibiotic, penem
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesKlebsiella pneumoniaewgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Escherichia colig+wgs, Klebsiella aerogenesg+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Raoultella planticolag+wgs, Serratia marcescenswgs
Classification38 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ lipopeptide antibiotic
+ mechanism of antibiotic resistance
+ beta-lactam antibiotic
+ antibiotic mixture
+ cephem
+ determinant of antibiotic resistance
+ polymyxin antibiotic
+ antibiotic efflux [Resistance Mechanism]
+ penam [Drug Class]
+ carbapenem [Drug Class]
+ aminoglycoside antibiotic [Drug Class]
+ polymyxin B
+ cephalosporin [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ macrolide antibiotic [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ penem [Drug Class]
+ ciprofloxacin [Antibiotic]
+ polymyxin B2 [Antibiotic]
+ polymyxin B3 [Antibiotic]
+ ticarcillin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ piperacillin [Antibiotic]
+ polymyxin B4 [Antibiotic]
+ streptomycin [Antibiotic]
+ spectinomycin [Antibiotic]
+ erythromycin [Antibiotic]
+ ertapenem [Antibiotic]
+ polymyxin B1 [Antibiotic]
+ norfloxacin [Antibiotic]
+ imipenem [Antibiotic]
+ azithromycin [Antibiotic]
+ ceftazidime [Antibiotic]
+ tobramycin [Antibiotic]
+ gentamicin C [Antibiotic]
Parent Term(s)3 ontology terms | Show
Publications

Srinivasan VB, et al. 2014. PLoS ONE 9(5):e96288 Role of novel multidrug efflux pump involved in drug resistance in Klebsiella pneumoniae. (PMID 24823362)

Resistomes

Prevalence of Klebsiella pneumoniae KpnG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.07%
Enterobacter asburiae0%0%1.19%
Enterobacter cloacae0%0%0.78%
Escherichia coli0.04%0%0.04%
Klebsiella aerogenes100%0%96.24%
Klebsiella oxytoca100%0%99.22%
Klebsiella pneumoniae98.6%0.05%99.62%
Pseudomonas aeruginosa0%0%0%
Raoultella planticola100%0%96.43%
Serratia marcescens0%0%0.18%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|EHL92831.1|+|Klebsiella pneumoniae KpnG [Klebsiella sp. 4_1_44FAA]
MSANAESQTPQQPGSKKGKRKGALLLLTLLFIIIAVAYGIYWFLVLRHYEETDDAYVAGNQVQIMAQVAGSVTKVWADNTDYVQKGDPLV
TLDRTDAQQAFEKAKTQLAASVRQTRQQMINSKQLQANIDVKKTALSQAQADLNRRIPLGAANLIGREELQHARDTVASAQAELDVAIQQ
YNANQAIVLGTRLEQQPAVLQAATEVRNAWLALQRTQIVSPISGYVSRRSVQPGAQIGTTTPLMAVVPATNLWIDANFKETQLAHMRIGQ
PATVISDIYGDDVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIELDEKQLAEHPLRIGLSTLVEVNTTDRDGEMLASQVR
SSPVYESNAREIALDPVNKLIDEIIQANAG


>gb|ACWO01000051.1|+|22093-23265|Klebsiella pneumoniae KpnG [Klebsiella sp. 4_1_44FAA]
ATGAGTGCAAATGCGGAGAGCCAAACCCCGCAGCAACCAGGCAGCAAAAAAGGAAAGCGTAAAGGCGCCCTTCTGTTGCTGACATTGCTC
TTCATTATTATTGCCGTGGCATATGGGATTTACTGGTTTCTGGTACTGCGTCACTACGAAGAGACCGACGATGCCTACGTGGCAGGGAAT
CAGGTACAAATTATGGCTCAGGTCGCGGGCAGCGTGACCAAAGTCTGGGCTGACAACACGGACTACGTGCAGAAAGGCGATCCGCTGGTC
ACTCTCGATCGGACCGATGCCCAACAGGCGTTTGAAAAGGCTAAGACCCAACTGGCCGCCAGCGTCCGTCAGACCCGCCAGCAGATGATC
AACAGCAAGCAGCTGCAGGCAAATATCGACGTCAAAAAAACCGCCCTCTCCCAGGCGCAGGCTGACCTGAACCGCCGCATCCCGCTGGGC
GCCGCGAACCTCATTGGCCGCGAAGAGCTGCAGCACGCCCGCGATACCGTCGCCAGCGCACAGGCCGAACTCGACGTGGCAATCCAGCAG
TACAACGCCAACCAGGCGATCGTGCTGGGCACCAGGCTGGAACAGCAGCCGGCGGTGCTCCAGGCGGCCACTGAAGTGCGTAACGCCTGG
CTGGCCCTGCAGCGTACGCAGATCGTCAGCCCGATTAGCGGCTACGTTTCCCGTCGCTCGGTACAGCCTGGCGCGCAGATCGGCACCACC
ACGCCGCTGATGGCGGTGGTCCCGGCGACCAACCTGTGGATCGATGCTAACTTTAAAGAGACTCAGCTGGCGCATATGCGTATCGGCCAG
CCGGCCACCGTGATCAGCGATATCTATGGCGATGACGTGAAATACACCGGTAAAGTGGTCGGTCTGGATATGGGTACCGGCAGCGCCTTC
TCCCTGCTGCCGGCGCAGAATGCCACCGGCAACTGGATCAAAGTGGTACAGCGCCTGCCGGTTCGTATCGAGCTGGATGAAAAACAACTA
GCGGAACACCCGCTGCGCATCGGCCTCTCGACGCTGGTGGAAGTCAACACCACCGATCGCGATGGTGAAATGCTGGCCAGCCAGGTGCGG
AGCTCCCCGGTTTACGAGAGCAATGCCCGCGAAATCGCTCTCGATCCGGTTAATAAGCTGATAGACGAGATCATTCAGGCCAACGCCGGA
TAA