Klebsiella pneumoniae KpnG

Accession ARO:3004588
Synonym(s)C8T8U1
DefinitionKpnG consists of ~390 residues and resembles EmrA of E. coli. Disruption of the pump components KpnG-KpnH signficantly decrease resistance to azithromycin, ceftazidime, ciprofloxacin, ertapenem, erythromycin, gentamicin, imipenem, ticarcillin, norfloxacin, polymyxin-B, piperacillin, spectinomycin, tobramycin, and streptomycin
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classpeptide antibiotic, tetracycline antibiotic, nucleoside antibiotic, carbapenem, penam, cephalosporin, aminoglycoside antibiotic, macrolide antibiotic, acridine dye, fluoroquinolone antibiotic, rifamycin antibiotic, phenicol antibiotic, bicyclomycin, antibacterial free fatty acids, diaminopyrimidine antibiotic, fosfomycin, isoniazid, nitroimidazole antibiotic, benzalkonium chloride, glycylcycline, lincosamide antibiotic, oxazolidinone antibiotic, penem, rhodamine
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification55 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ beta-lactam antibiotic
+ lipopeptide antibiotic
+ mechanism of antibiotic resistance
+ antibiotic without defined classification
+ polymyxin antibiotic
+ antibiotic efflux [Resistance Mechanism]
+ antibiotic mixture
+ cephem
+ tetracycline antibiotic [Drug Class]
+ determinant of antibiotic resistance
+ nucleoside antibiotic [Drug Class]
+ carbapenem [Drug Class]
+ penam [Drug Class]
+ cephalosporin [Drug Class]
+ aminoglycoside antibiotic [Drug Class]
+ polymyxin B
+ macrolide antibiotic [Drug Class]
+ acridine dye [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ rifamycin antibiotic [Drug Class]
+ phenicol antibiotic [Drug Class]
+ bicyclomycin [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ antibacterial free fatty acids [Drug Class]
+ diaminopyrimidine antibiotic [Drug Class]
+ fosfomycin [Drug Class]
+ isoniazid [Drug Class]
+ nitroimidazole antibiotic [Drug Class]
+ benzalkonium chloride [Drug Class]
+ glycylcycline [Drug Class]
+ lincosamide antibiotic [Drug Class]
+ oxazolidinone antibiotic [Drug Class]
+ penem [Drug Class]
+ rhodamine [Drug Class]
+ ciprofloxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ erythromycin [Antibiotic]
+ norfloxacin [Antibiotic]
+ polymyxin B2 [Antibiotic]
+ polymyxin B3 [Antibiotic]
+ ticarcillin [Antibiotic]
+ polymyxin B1 [Antibiotic]
+ polymyxin B4 [Antibiotic]
+ tobramycin [Antibiotic]
+ spectinomycin [Antibiotic]
+ ertapenem [Antibiotic]
+ piperacillin [Antibiotic]
+ azithromycin [Antibiotic]
+ ceftazidime [Antibiotic]
+ streptomycin [Antibiotic]
+ imipenem [Antibiotic]
+ gentamicin C [Antibiotic]
Parent Term(s)3 ontology terms | Show
Publications

Srinivasan VB, et al. 2014. PLoS ONE 9(5):e96288 Role of novel multidrug efflux pump involved in drug resistance in Klebsiella pneumoniae. (PMID 24823362)

Resistomes

Prevalence of Klebsiella pneumoniae KpnG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.04%
Enterobacter cloacae0%0%0.9%
Escherichia coli0%0%0.03%
Klebsiella oxytoca100%0%97.2%
Raoultella planticola100%0%100%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|EHL92831.1|+|Klebsiella pneumoniae KpnG [Klebsiella sp. 4_1_44FAA]
MSANAESQTPQQPGSKKGKRKGALLLLTLLFIIIAVAYGIYWFLVLRHYEETDDAYVAGNQVQIMAQVAGSVTKVWADNTDYVQKGDPLV
TLDRTDAQQAFEKAKTQLAASVRQTRQQMINSKQLQANIDVKKTALSQAQADLNRRIPLGAANLIGREELQHARDTVASAQAELDVAIQQ
YNANQAIVLGTRLEQQPAVLQAATEVRNAWLALQRTQIVSPISGYVSRRSVQPGAQIGTTTPLMAVVPATNLWIDANFKETQLAHMRIGQ
PATVISDIYGDDVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIELDEKQLAEHPLRIGLSTLVEVNTTDRDGEMLASQVR
SSPVYESNAREIALDPVNKLIDEIIQANAG


>gb|ACWO01000051.1|+|22093-23265|Klebsiella pneumoniae KpnG [Klebsiella sp. 4_1_44FAA]
ATGAGTGCAAATGCGGAGAGCCAAACCCCGCAGCAACCAGGCAGCAAAAAAGGAAAGCGTAAAGGCGCCCTTCTGTTGCTGACATTGCTC
TTCATTATTATTGCCGTGGCATATGGGATTTACTGGTTTCTGGTACTGCGTCACTACGAAGAGACCGACGATGCCTACGTGGCAGGGAAT
CAGGTACAAATTATGGCTCAGGTCGCGGGCAGCGTGACCAAAGTCTGGGCTGACAACACGGACTACGTGCAGAAAGGCGATCCGCTGGTC
ACTCTCGATCGGACCGATGCCCAACAGGCGTTTGAAAAGGCTAAGACCCAACTGGCCGCCAGCGTCCGTCAGACCCGCCAGCAGATGATC
AACAGCAAGCAGCTGCAGGCAAATATCGACGTCAAAAAAACCGCCCTCTCCCAGGCGCAGGCTGACCTGAACCGCCGCATCCCGCTGGGC
GCCGCGAACCTCATTGGCCGCGAAGAGCTGCAGCACGCCCGCGATACCGTCGCCAGCGCACAGGCCGAACTCGACGTGGCAATCCAGCAG
TACAACGCCAACCAGGCGATCGTGCTGGGCACCAGGCTGGAACAGCAGCCGGCGGTGCTCCAGGCGGCCACTGAAGTGCGTAACGCCTGG
CTGGCCCTGCAGCGTACGCAGATCGTCAGCCCGATTAGCGGCTACGTTTCCCGTCGCTCGGTACAGCCTGGCGCGCAGATCGGCACCACC
ACGCCGCTGATGGCGGTGGTCCCGGCGACCAACCTGTGGATCGATGCTAACTTTAAAGAGACTCAGCTGGCGCATATGCGTATCGGCCAG
CCGGCCACCGTGATCAGCGATATCTATGGCGATGACGTGAAATACACCGGTAAAGTGGTCGGTCTGGATATGGGTACCGGCAGCGCCTTC
TCCCTGCTGCCGGCGCAGAATGCCACCGGCAACTGGATCAAAGTGGTACAGCGCCTGCCGGTTCGTATCGAGCTGGATGAAAAACAACTA
GCGGAACACCCGCTGCGCATCGGCCTCTCGACGCTGGTGGAAGTCAACACCACCGATCGCGATGGTGAAATGCTGGCCAGCCAGGTGCGG
AGCTCCCCGGTTTACGAGAGCAATGCCCGCGAAATCGCTCTCGATCCGGTTAATAAGCTGATAGACGAGATCATTCAGGCCAACGCCGGA
TAA