Klebsiella pneumoniae KpnH

Accession ARO:3004597
Synonym(s)A0A3F3BH25
DefinitionKpnH consists of ~511 residues, resembles EmrB of E. coli, and is probably a translocase in the KpnGH-TolC efflux protein in K. pneumoniae. Disruption of the pump components KpnG-KpnH signficantly decrease resistance to azithromycin, ceftazidime, ciprofloxacin, ertapenem, erythromycin, gentamicin, imipenem, ticarcillin, norfloxacin, polymyxin-B, piperacillin, spectinomycin, tobramycin, and streptomycin.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classpeptide antibiotic, tetracycline antibiotic, penam, fluoroquinolone antibiotic, isoniazid, nitroimidazole antibiotic, macrolide antibiotic, bicyclomycin, fosfomycin, aminoglycoside antibiotic, acridine dye, cephalosporin, rhodamine, lincosamide antibiotic, antibacterial free fatty acids, benzalkonium chloride, penem, nucleoside antibiotic, phenicol antibiotic, oxazolidinone antibiotic, carbapenem, diaminopyrimidine antibiotic, rifamycin antibiotic, glycylcycline
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia coliwgs
Classification55 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ lipopeptide antibiotic
+ beta-lactam antibiotic
+ mechanism of antibiotic resistance
+ antibiotic mixture
+ antibiotic without defined classification
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ polymyxin antibiotic
+ cephem
+ tetracycline antibiotic [Drug Class]
+ penam [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ isoniazid [Drug Class]
+ nitroimidazole antibiotic [Drug Class]
+ macrolide antibiotic [Drug Class]
+ bicyclomycin [Drug Class]
+ fosfomycin [Drug Class]
+ aminoglycoside antibiotic [Drug Class]
+ polymyxin B
+ acridine dye [Drug Class]
+ cephalosporin [Drug Class]
+ rhodamine [Drug Class]
+ lincosamide antibiotic [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ antibacterial free fatty acids [Drug Class]
+ benzalkonium chloride [Drug Class]
+ penem [Drug Class]
+ nucleoside antibiotic [Drug Class]
+ phenicol antibiotic [Drug Class]
+ oxazolidinone antibiotic [Drug Class]
+ carbapenem [Drug Class]
+ diaminopyrimidine antibiotic [Drug Class]
+ rifamycin antibiotic [Drug Class]
+ glycylcycline [Drug Class]
+ polymyxin B2 [Antibiotic]
+ ceftazidime [Antibiotic]
+ ertapenem [Antibiotic]
+ erythromycin [Antibiotic]
+ polymyxin B1 [Antibiotic]
+ streptomycin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ tobramycin [Antibiotic]
+ spectinomycin [Antibiotic]
+ ticarcillin [Antibiotic]
+ imipenem [Antibiotic]
+ piperacillin [Antibiotic]
+ gentamicin C [Antibiotic]
+ polymyxin B3 [Antibiotic]
+ azithromycin [Antibiotic]
+ polymyxin B4 [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ norfloxacin [Antibiotic]
Parent Term(s)3 ontology terms | Show
Publications

Srinivasan VB, et al. 2014. PLoS ONE 9(5):e96288 Role of novel multidrug efflux pump involved in drug resistance in Klebsiella pneumoniae. (PMID 24823362)

Resistomes

Prevalence of Klebsiella pneumoniae KpnH among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter amalonaticus0%0%11.11%
Citrobacter freundii3.45%0%0.78%
Enterobacter asburiae0%0%1.56%
Enterobacter cloacae0%0%3.39%
Enterobacter kobei0%0%1.56%
Escherichia coli0.07%0%1.16%
Haemophilus influenzae24.19%0%10.05%
Haemophilus parainfluenzae0%0%22.86%
Klebsiella oxytoca100%0%97.2%
Morganella morganii100%0%95.24%
Proteus mirabilis100%0%93.1%
Proteus penneri0%0%100%
Proteus vulgaris100%0%100%
Providencia rettgeri100%0%100%
Providencia stuartii100%0%92.31%
Raoultella planticola80%0%94.74%
Salmonella enterica2.33%0%0.4%
Serratia liquefaciens100%0%100%
Serratia marcescens100%1.64%97.24%
Serratia odorifera100%0%100%
Shigella dysenteriae44.44%0%17.14%
Shigella flexneri3.03%0%0.52%
Shigella sonnei0%0%0.39%
Yersinia enterocolitica100%0%100%
Yersinia pestis97.56%0%95.51%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|EOU56998.1|+|Klebsiella pneumoniae KpnH [Escherichia coli KTE14]
MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFA
IASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVA
VVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIVWELTDDNPIVDLSLFKSRNF
TIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMD
FGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTTMWTNRESMHHAQLTESVNPFNPNAQAMYSQL
EGLGMTQQQASGWIAQQITNQGLIISANEIFWMSAGIFLILLGLVWFAKPPFGAGGGGGGAH


>gb|ASTU01000063.1|+|61249-62787|Klebsiella pneumoniae KpnH [Escherichia coli KTE14]
ATGCAACAGCAAAAACCGCTGGAAGGCGCGCAACTGGTCATTATGACGATTGCGCTGTCACTGGCGACATTCATGCAGGTGCTGGACTCC
ACCATTGCTAACGTGGCGATCCCCACTATCGCCGGGAATCTGGGCTCATCGCTCAGCCAGGGAACGTGGGTAATCACTTCTTTCGGGGTG
GCGAATGCCATCTCGATCCCGCTTACCGGCTGGCTGGCAAAGCGCGTCGGGGAAGTGAAACTGTTCCTTTGGTCCACCATCGCCTTTGCT
ATTGCGTCGTGGGCGTGTGGTGTCTCCAGCAGCCTGAATATGCTGATCTTCTTCCGCGTGATTCAGGGGATTGTCGCCGGGCCGTTGATC
CCGCTTTCGCAAAGTCTATTGCTGAATAACTACCCGCCAGCCAAACGCTCGATCGCGCTGGCGTTGTGGTCGATGACGGTGATTGTCGCG
CCAATTTGCGGCCCGATCCTCGGCGGTTATATCAGCGATAATTACCACTGGGGCTGGATATTCTTCATCAACGTGCCGATTGGCGTGGCG
GTGGTGTTGATGACACTGCAAACTCTGCGCGGACGTGAAACCCGCACCGAACGGCGGCGGATTGATGCCGTGGGGCTGGCACTGCTGGTT
ATTGGTATCGGCAGCCTGCAGATTATGCTCGACCGCGGTAAAGAGCTGGACTGGTTTTCATCACAGGAAATTATCATCCTTACCGTGGTG
GCGGTGGTGGCTATCTGCTTCCTGATTGTCTGGGAGCTGACCGACGATAACCCGATAGTCGATCTGTCGTTGTTTAAGTCGCGCAACTTC
ACCATCGGCTGCTTGTGTATCAGCCTCGCGTATATGCTCTACTTCGGCGCTATTGTTCTGCTGCCGCAGTTGTTGCAGGAGGTCTACGGT
TACACGGCGACCTGGGCAGGTTTGGCCTCTGCGCCGGTAGGGATTATTCCGGTGATCCTGTCGCCGATTATCGGCCGCTTCGCGCATAAA
CTGGATATGCGGCGGCTGGTAACCTTCAGCTTTATTATGTATGCCGTCTGCTTCTACTGGCGTGCCTATACCTTTGAACCAGGTATGGAT
TTTGGCGCGTCGGCCTGGCCGCAGTTTATCCAGGGGTTTGCGGTGGCCTGCTTCTTTATGCCGCTGACCACCATTACGCTGTCTGGTTTG
CCACCGGAACGACTGGCGGCGGCATCGAGCCTCTCTAACTTTACGCGAACGCTGGCGGGGTCTATCGGCACGTCGATAACCACGACCATG
TGGACCAACCGCGAGTCGATGCACCATGCGCAGTTGACTGAGTCGGTAAACCCGTTCAACCCGAATGCCCAGGCGATGTACAGTCAACTG
GAAGGGCTTGGGATGACGCAACAGCAGGCATCAGGCTGGATTGCCCAGCAGATCACCAATCAGGGGCTGATTATTTCCGCCAATGAGATC
TTCTGGATGTCAGCCGGGATATTCCTCATCCTGCTGGGGCTGGTGTGGTTTGCTAAACCGCCATTTGGCGCAGGTGGCGGCGGAGGCGGT
GCGCACTAA