Klebsiella pneumoniae KpnH

Download Sequences

Accession	ARO:3004597
Synonym(s)	A0A3F3BH25
CARD Short Name	Kpne_KpnH
Definition	KpnH consists of ~511 residues, resembles EmrB of E. coli, and is probably a translocase in the KpnGH-TolC efflux protein in K. pneumoniae. Disruption of the pump components KpnG-KpnH signficantly decrease resistance to azithromycin, ceftazidime, ciprofloxacin, ertapenem, erythromycin, gentamicin, imipenem, ticarcillin, norfloxacin, polymyxin-B, piperacillin, spectinomycin, tobramycin, and streptomycin.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	peptide antibiotic, penicillin beta-lactam, cephalosporin, aminoglycoside antibiotic, carbapenem, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Escherichia albertii^g, Escherichia coli^g+wgs, Shigella flexneri^wgs
Resistomes with Sequence Variants	Avibacterium paragallinarum^g+wgs, Citrobacter freundii^g+wgs, Citrobacter werkmanii^g, Cronobacter condimenti^g+wgs, Cronobacter dublinensis^g+wgs, Edwardsiella tarda^g+wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^g+wgs, Enterobacter hormaechei^g+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia albertii^g+wgs, Escherichia coli^g+wgs, Escherichia marmotae^wgs, Haemophilus influenzae^g+wgs, Haemophilus parainfluenzae^g+wgs, Klebsiella aerogenes^g+wgs, Klebsiella huaxiensis^g+wgs, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^g+wgs, Kosakonia arachidis^g+wgs, Leminorella grimontii^wgs, Morganella morganii^g+wgs, Pectobacterium parmentieri^g+wgs, Photorhabdus asymbiotica^g+wgs, Plesiomonas shigelloides^g+wgs, Proteus columbae^g+wgs, Proteus mirabilis^g+wgs, Proteus penneri^g+wgs, Proteus vulgaris^g+wgs, Providencia alcalifaciens^g+p+wgs, Providencia heimbachae^g+wgs, Providencia rettgeri^g+wgs, Providencia stuartii^g+wgs, Raoultella planticola^g+wgs, Salmonella enterica^g+wgs, Serratia liquefaciens^g+wgs, Serratia marcescens^g+p+wgs, Serratia odorifera^g+wgs, Serratia rubidaea^g+wgs, Shigella boydii^g, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^wgs, Yersinia canariae^g+wgs, Yersinia enterocolitica^g+wgs, Yersinia kristensenii^g+wgs, Yersinia pestis^g+wgs, Yersinia pseudotuberculosis^g+wgs
Classification	39 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + peptide antibiotic [Drug Class] + lipopeptide antibiotic + beta-lactam antibiotic + mechanism of antibiotic resistance + antibiotic mixture + penicillin beta-lactam [Drug Class] + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + cephalosporin [Drug Class] + polymyxin antibiotic + aminoglycoside antibiotic [Drug Class] + penicillin with extended spectrum + third-generation cephalosporin + gentamicin [Antibiotic] + polymyxin B [Antibiotic] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + carbapenem [Drug Class] + fluoroquinolone antibiotic [Drug Class] + macrolide antibiotic [Drug Class] + ticarcillin [Antibiotic] + norfloxacin [Antibiotic] + polymyxin B4 [Antibiotic] + polymyxin B3 [Antibiotic] + polymyxin B2 [Antibiotic] + polymyxin B1 [Antibiotic] + imipenem [Antibiotic] + azithromycin [Antibiotic] + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family] + piperacillin [Antibiotic] + ertapenem [Antibiotic] + ceftazidime [Antibiotic] + tobramycin [Antibiotic] + streptomycin [Antibiotic] + spectinomycin [Antibiotic] + ciprofloxacin [Antibiotic] + gentamicin C [Antibiotic] + erythromycin [Antibiotic]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_drug_class cephalosporin [Drug Class] + subunit of efflux pump conferring antibiotic resistance + part_of Klebsiella pneumoniae KpnGH-TolC
Publications	Srinivasan VB, et al. 2014. PLoS ONE 9(5):e96288 Role of novel multidrug efflux pump involved in drug resistance in Klebsiella pneumoniae. (PMID 24823362)

Resistomes

Prevalence of Klebsiella pneumoniae KpnH among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Avibacterium paragallinarum	100%	0%	94.12%	0%	0%
Avibacterium paragallinarum	0%	0%	0%	0%	0%
Citrobacter freundii	21.31%	0%	1.35%	0%	0%
Citrobacter freundii	0%	0%	0%	0%	0%
Citrobacter werkmanii	0%	0%	0%	0%	0%
Citrobacter werkmanii	28.57%	0%	0%	0%	0%
Cronobacter condimenti	100%	0%	50%	0%	0%
Cronobacter condimenti	0%	0%	0%	0%	0%
Cronobacter dublinensis	0%	0%	0%	0%	0%
Cronobacter dublinensis	33.33%	0%	15.38%	0%	0%
Edwardsiella tarda	100%	0%	93.33%	0%	0%
Edwardsiella tarda	0%	0%	0%	0%	0%
Enterobacter asburiae	0%	0%	0.79%	0%	0%
Enterobacter asburiae	0%	0%	0%	0%	0%
Enterobacter cloacae	1.79%	0%	1.6%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0%	0%	0%
Enterobacter hormaechei	0.36%	0%	0.35%	0%	0%
Enterobacter kobei	0%	0%	0%	0%	0%
Enterobacter kobei	0%	0%	0.44%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%	0%
Enterobacter roggenkampii	0%	0%	2.16%	0%	0%
Escherichia albertii	11.43%	0%	2.58%	0%	0%
Escherichia albertii	1.43%	0%	0%	0%	0%
Escherichia coli	0.07%	0%	0.15%	0%	0%
Escherichia coli	0.29%	0%	0.62%	0%	0.09%
Escherichia marmotae	0%	0%	2.08%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Haemophilus influenzae	0%	0%	0%	0%	0%
Haemophilus influenzae	19.59%	0%	15.66%	0%	0%
Haemophilus parainfluenzae	68.75%	0%	21.95%	0%	0%
Haemophilus parainfluenzae	0%	0%	0%	0%	0%
Klebsiella aerogenes	100%	0%	99.72%	0%	0%
Klebsiella aerogenes	0%	0%	0%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	0%	0%
Klebsiella huaxiensis	100%	0%	100%	0%	0%
Klebsiella michiganensis	100%	0%	99.73%	0%	0%
Klebsiella michiganensis	0%	0%	0%	0%	0%
Klebsiella oxytoca	100%	0%	100%	0%	0%
Klebsiella oxytoca	0%	0%	0%	0%	0%
Klebsiella pneumoniae	99.41%	0.02%	99.25%	0%	0%
Klebsiella pneumoniae	0%	0%	0%	0%	0%
Klebsiella quasipneumoniae	100%	0%	99.87%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0%	0%	0%
Kosakonia arachidis	100%	0%	100%	0%	0%
Kosakonia arachidis	0%	0%	0%	0%	0%
Leminorella grimontii	0%	0%	0%	0%	0%
Leminorella grimontii	0%	0%	85.71%	0%	0%
Morganella morganii	0%	0%	0%	0%	0%
Morganella morganii	100%	0%	98.77%	0%	0%
Pectobacterium parmentieri	100%	0%	94.12%	0%	0%
Pectobacterium parmentieri	0%	0%	0%	0%	0%
Photorhabdus asymbiotica	0%	0%	0%	0%	0%
Photorhabdus asymbiotica	100%	0%	100%	0%	0%
Plesiomonas shigelloides	0%	0%	0%	0%	0%
Plesiomonas shigelloides	75%	0%	89.66%	0%	0%
Proteus columbae	100%	0%	100%	0%	0%
Proteus columbae	0%	0%	0%	0%	0%
Proteus mirabilis	0%	0%	0%	0%	0%
Proteus mirabilis	100%	0%	98.02%	0%	0%
Proteus penneri	100%	0%	100%	0%	0%
Proteus penneri	0%	0%	0%	0%	0%
Proteus vulgaris	0%	0%	0%	0%	0%
Proteus vulgaris	90.91%	0%	100%	0%	0%
Providencia alcalifaciens	0%	0%	0%	0%	0%
Providencia alcalifaciens	90.91%	4%	100%	0%	0%
Providencia heimbachae	0%	0%	0%	0%	0%
Providencia heimbachae	100%	0%	100%	0%	0%
Providencia rettgeri	0%	0%	0%	0%	0%
Providencia rettgeri	100%	0%	98.09%	0%	0%
Providencia stuartii	0%	0%	0%	0%	0%
Providencia stuartii	100%	0%	97.73%	0%	0%
Raoultella planticola	100%	0%	100%	0%	0%
Raoultella planticola	0%	0%	0%	0%	0%
Salmonella enterica	0.57%	0%	1.41%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Serratia liquefaciens	0%	0%	0%	0%	0%
Serratia liquefaciens	100%	0%	100%	0%	0%
Serratia marcescens	98.48%	0.65%	97.64%	0%	0%
Serratia marcescens	0%	0%	0%	0%	0%
Serratia odorifera	100%	0%	100%	0%	0%
Serratia odorifera	0%	0%	0%	0%	0%
Serratia rubidaea	100%	0%	100%	0%	0%
Serratia rubidaea	0%	0%	0%	0%	0%
Shigella boydii	0%	0%	0%	0%	0%
Shigella boydii	6.67%	0%	0%	0%	0%
Shigella dysenteriae	0%	0%	0%	0%	0%
Shigella dysenteriae	71.43%	0%	20%	0%	0%
Shigella flexneri	0%	0%	0.16%	0%	0%
Shigella flexneri	1%	0%	0.62%	0%	0%
Shigella sonnei	0%	0%	0%	0%	0%
Shigella sonnei	0%	0%	0.37%	0%	0%
Yersinia canariae	100%	0%	100%	0%	0%
Yersinia canariae	0%	0%	0%	0%	0%
Yersinia enterocolitica	100%	0%	100%	0%	0%
Yersinia enterocolitica	0%	0%	0%	0%	0%
Yersinia kristensenii	100%	0%	100%	0%	0%
Yersinia kristensenii	0%	0%	0%	0%	0%
Yersinia pestis	0%	0%	0%	0%	0%
Yersinia pestis	98.46%	0%	98.24%	0%	0%
Yersinia pseudotuberculosis	0%	0%	0%	0%	0%
Yersinia pseudotuberculosis	100%	0%	100%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700

Protein
DNA

>gb|EOU56998.1|+|Klebsiella pneumoniae KpnH [Escherichia coli KTE14]
MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFA
IASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVA
VVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIVWELTDDNPIVDLSLFKSRNF
TIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMD
FGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTTMWTNRESMHHAQLTESVNPFNPNAQAMYSQL
EGLGMTQQQASGWIAQQITNQGLIISANEIFWMSAGIFLILLGLVWFAKPPFGAGGGGGGAH

>gb|ASTU01000063.1|+|61249-62787|Klebsiella pneumoniae KpnH [Escherichia coli KTE14]
ATGCAACAGCAAAAACCGCTGGAAGGCGCGCAACTGGTCATTATGACGATTGCGCTGTCACTGGCGACATTCATGCAGGTGCTGGACTCC
ACCATTGCTAACGTGGCGATCCCCACTATCGCCGGGAATCTGGGCTCATCGCTCAGCCAGGGAACGTGGGTAATCACTTCTTTCGGGGTG
GCGAATGCCATCTCGATCCCGCTTACCGGCTGGCTGGCAAAGCGCGTCGGGGAAGTGAAACTGTTCCTTTGGTCCACCATCGCCTTTGCT
ATTGCGTCGTGGGCGTGTGGTGTCTCCAGCAGCCTGAATATGCTGATCTTCTTCCGCGTGATTCAGGGGATTGTCGCCGGGCCGTTGATC
CCGCTTTCGCAAAGTCTATTGCTGAATAACTACCCGCCAGCCAAACGCTCGATCGCGCTGGCGTTGTGGTCGATGACGGTGATTGTCGCG
CCAATTTGCGGCCCGATCCTCGGCGGTTATATCAGCGATAATTACCACTGGGGCTGGATATTCTTCATCAACGTGCCGATTGGCGTGGCG
GTGGTGTTGATGACACTGCAAACTCTGCGCGGACGTGAAACCCGCACCGAACGGCGGCGGATTGATGCCGTGGGGCTGGCACTGCTGGTT
ATTGGTATCGGCAGCCTGCAGATTATGCTCGACCGCGGTAAAGAGCTGGACTGGTTTTCATCACAGGAAATTATCATCCTTACCGTGGTG
GCGGTGGTGGCTATCTGCTTCCTGATTGTCTGGGAGCTGACCGACGATAACCCGATAGTCGATCTGTCGTTGTTTAAGTCGCGCAACTTC
ACCATCGGCTGCTTGTGTATCAGCCTCGCGTATATGCTCTACTTCGGCGCTATTGTTCTGCTGCCGCAGTTGTTGCAGGAGGTCTACGGT
TACACGGCGACCTGGGCAGGTTTGGCCTCTGCGCCGGTAGGGATTATTCCGGTGATCCTGTCGCCGATTATCGGCCGCTTCGCGCATAAA
CTGGATATGCGGCGGCTGGTAACCTTCAGCTTTATTATGTATGCCGTCTGCTTCTACTGGCGTGCCTATACCTTTGAACCAGGTATGGAT
TTTGGCGCGTCGGCCTGGCCGCAGTTTATCCAGGGGTTTGCGGTGGCCTGCTTCTTTATGCCGCTGACCACCATTACGCTGTCTGGTTTG
CCACCGGAACGACTGGCGGCGGCATCGAGCCTCTCTAACTTTACGCGAACGCTGGCGGGGTCTATCGGCACGTCGATAACCACGACCATG
TGGACCAACCGCGAGTCGATGCACCATGCGCAGTTGACTGAGTCGGTAAACCCGTTCAACCCGAATGCCCAGGCGATGTACAGTCAACTG
GAAGGGCTTGGGATGACGCAACAGCAGGCATCAGGCTGGATTGCCCAGCAGATCACCAATCAGGGGCTGATTATTTCCGCCAATGAGATC
TTCTGGATGTCAGCCGGGATATTCCTCATCCTGCTGGGGCTGGTGTGGTTTGCTAAACCGCCATTTGGCGCAGGTGGCGGCGGAGGCGGT
GCGCACTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

Klebsiella pneumoniae KpnH

Prevalence: protein homolog model (view sequences)

Graph