Escherichia coli soxS with mutation conferring antibiotic resistance

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003511
CARD Short NameEcol_soxS_MULT
DefinitionSoxS is a global regulator that up-regulates the expression of AcrAB efflux genes. It also reduces OmpF expression to decrease cell membrane permeability.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, major facilitator superfamily (MFS) antibiotic efflux pump, ATP-binding cassette (ABC) antibiotic efflux pump, antibiotic efflux regulatory protein, General Bacterial Porin with reduced permeability to beta-lactams
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic, carbapenem, monobactam
Resistance Mechanismreduced permeability to antibiotic, antibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification46 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ beta-lactam antibiotic
+ mechanism of antibiotic resistance
+ reduced permeability to antibiotic [Resistance Mechanism]
+ tetracycline antibiotic [Drug Class]
+ penicillin beta-lactam [Drug Class]
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ cephalosporin [Drug Class]
+ penicillin with extended spectrum
+ first-generation cephalosporin [Drug Subclass]
+ disinfecting agents and antiseptics [Drug Class]
+ phenicol antibiotic [Drug Class]
+ protein modulating permeability to antibiotic
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ rifamycin antibiotic [Drug Class]
+ antibiotic target alteration [Resistance Mechanism]
+ glycylcycline [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ General Bacterial Porin (GBP)
+ triclosan [Antibiotic]
+ cefalotin [Antibiotic]
+ norfloxacin [Antibiotic]
+ ampicillin [Antibiotic]
+ protein(s) or two-component regulatory system modulating antibiotic efflux [Efflux Regulator]
+ chloramphenicol [Antibiotic]
+ mutation conferring antibiotic resistance
+ rifampin [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ ATP-binding cassette (ABC) antibiotic efflux pump [AMR Gene Family]
+ tetracycline [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ tigecycline [Antibiotic]
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ antibiotic efflux regulatory protein [AMR Gene Family]
+ General Bacterial Porin with reduced permeability to beta-lactams [AMR Gene Family]
+ PatA-PatB
+ QepA1
+ AcrAB-TolC
+ antibiotic resistance gene variant or mutant
+ soxRS
+ porin OmpF
+ mutant efflux regulatory protein conferring antibiotic resistance
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ soxS
+ confers_resistance_to_antibiotic enrofloxacin [Antibiotic]
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Citrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella aerogenesg+wgs, Klebsiella oxytocap, Klebsiella pneumoniaewgs, Salmonella bongorig+wgs, Salmonella entericag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Publications

Aly SA, et al. 2015. J. Antimicrob. Chemother. 70(8):2228-33 A novel alanine to serine substitution mutation in SoxS induces overexpression of efflux pumps and contributes to multidrug resistance in clinical Escherichia coli isolates. (PMID 25921515)

Resistomes

Prevalence of Escherichia coli soxS with mutation conferring antibiotic resistance among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein overexpression model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus100%0%100%0%0%
Citrobacter freundii99.18%0%97.68%0%0%
Citrobacter koseri100%0%100%0%0%
Citrobacter portucalensis100%0%100%0%0%
Citrobacter werkmanii100%0%100%0%0%
Citrobacter youngae100%0%100%0%0%
Enterobacter cloacae0%0%0.64%0%0%
Enterobacter hormaechei0%0%0.13%0%0%
Escherichia albertii100%0%100%0%0%
Escherichia coli67.77%0.02%99.36%0%99.82%
Escherichia fergusonii100%0%100%0%0%
Escherichia marmotae100%0%97.92%0%0%
Klebsiella aerogenes98%0%95.76%0%0%
Klebsiella oxytoca0%0.68%0%0%0%
Klebsiella pneumoniae0%0%0.04%0%0%
Salmonella bongori100%0%100%0%0%
Salmonella enterica95.71%0%99.72%0%0%
Shigella boydii93.33%0%95.56%0%0%
Shigella dysenteriae100%0%100%0%0%
Shigella flexneri99%0%99.69%0%0%
Shigella sonnei97.56%0%98.69%0%0%
Show Perfect Only


Detection Models

Model Type: protein overexpression model

Model Definition: Protein Overexpression Models (POM) are similar to Protein Variant Models (PVM) in that they include a protein reference sequence, a curated BLASTP bitscore cut-off, and mapped resistance variants. Whereas PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, reporting only those with curated mutations conferring AMR, POMs are restricted to regulatory proteins and report both wild-type sequences and/or sequences with mutations leading to overexpression of efflux complexes. The former lead to efflux of antibiotics at basal levels, while the latter can confer clinical resistance. POMs include a protein reference sequence (often from wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Perfect RGI match is 100% identical to the wild-type reference protein sequence along its entire length, a Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value may or may not contain at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off may or may not contain at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 200

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
A12Ssingle resistance variantPMID:25921515

>gb|AAC77032.1|-|Escherichia coli soxS with mutation conferring antibiotic resistance [Escherichia coli str. K-12 substr. MG1655]
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLL
LAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRRQFDRTPSDYRHRL



>gb|U00096.3|-|4277060-4277383|Escherichia coli soxS with mutation conferring antibiotic resistance [Escherichia coli str. K-12 substr. MG1655]
ATGTCCCATCAGAAAATTATTCAGGATCTTATCGCATGGATTGACGAGCATATTGACCAGCCGCTTAACATTGATGTAGTCGCAAAAAAA
TCAGGCTATTCAAAGTGGTACTTGCAACGAATGTTCCGCACGGTGACGCATCAGACGCTTGGCGATTACATTCGCCAACGCCGCCTGTTA
CTGGCCGCCGTTGAGTTGCGCACCACCGAGCGTCCGATTTTTGATATCGCAATGGACCTGGGTTATGTCTCGCAGCAGACCTTCTCCCGC
GTTTTCCGTCGGCAGTTTGATCGCACTCCCAGCGATTATCGCCACCGCCTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit