Pseudomonas aeruginosa CpxR

Accession ARO:3004054
DefinitionCpxR is directly involved in activation of expression of RND efflux pump MexAB-OprM in P. aeruginosa. CpxR is required to enhance mexAB-oprM expression and drug resistance, in the absence of repressor MexR.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpeptide antibiotic, diaminopyrimidine antibiotic, aminocoumarin antibiotic, sulfonamide antibiotic, penam, fluoroquinolone antibiotic, macrolide antibiotic, cephalosporin, aminoglycoside antibiotic, carbapenem, tetracycline antibiotic, phenicol antibiotic, monobactam, cephamycin, penem
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
ResistomesPseudomonas fluorescensg
Classification57 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ mechanism of antibiotic resistance
+ lipopeptide antibiotic
+ antibiotic efflux [Resistance Mechanism]
+ determinant of antibiotic resistance
+ resistance-modifying agents
+ beta-lactam antibiotic
+ polymyxin antibiotic
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ diaminopyrimidine antibiotic [Drug Class]
+ aminocoumarin antibiotic [Drug Class]
+ cephem
+ sulfonamide antibiotic [Drug Class]
+ penam [Drug Class]
+ beta-lactamase inhibitor
+ amoxicillin [Antibiotic]
+ antibiotic mixture
+ fluoroquinolone antibiotic [Drug Class]
+ novobiocin [Antibiotic]
+ macrolide antibiotic [Drug Class]
+ cephalosporin [Drug Class]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ aminoglycoside antibiotic [Drug Class]
+ carbapenem [Drug Class]
+ tetracycline antibiotic [Drug Class]
+ clavulanic acid [Adjuvant]
+ sulfamethoxazole [Antibiotic]
+ trimethoprim [Antibiotic]
+ phenicol antibiotic [Drug Class]
+ monobactam [Drug Class]
+ colistin
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ cephamycin [Drug Class]
+ penem [Drug Class]
+ ceftazidime [Antibiotic]
+ chloramphenicol [Antibiotic]
+ tetracycline [Antibiotic]
+ ampicillin [Antibiotic]
+ colistin A [Antibiotic]
+ meropenem [Antibiotic]
+ ceftriaxone [Antibiotic]
+ erythromycin [Antibiotic]
+ aztreonam [Antibiotic]
+ protein(s) and two-component regulatory system modulating antibiotic efflux [Efflux Regulator]
+ azithromycin [Antibiotic]
+ colistin B [Antibiotic]
+ amoxicillin-clavulanic acid [Antibiotic]
+ acrD
+ panipenem [Antibiotic]
+ MdtABC-TolC
+ AcrAD-TolC
+ MexAB-OprM
+ protein of two-component regulatory system modulating antibiotic efflux
+ cpxAR
Parent Term(s)2 ontology terms | Show
Publications

Tian ZX, et al. 2016. PLoS Pathog. 12(10):e1005932 CpxR Activates MexAB-OprM Efflux Pump Expression and Enhances Antibiotic Resistance in Both Laboratory and Clinical nalB-Type Isolates of Pseudomonas aeruginosa. (PMID 27736975)

Resistomes

Prevalence of Pseudomonas aeruginosa CpxR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Klebsiella pneumoniae0%0%0%
Proteus mirabilis0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 400


>gb|SIP52035.1|-|Pseudomonas aeruginosa CpxR [Pseudomonas aeruginosa]
MSELLLIDDDRELCELLGTWLVQEGFSVRASHDGAQARRALAEQTPDAVVLDVMLPDGSGLELLKQLRGDHPDLPVLMLSARGEPLDRIL
GLELGADDYLAKPCDPRELTARLRAVLRRTHPAQPSAQMQLGDLSLNLTRGVAQIDGQEISLTLSESRILEALLRQPGEPLDKQALAQLA
LGRKLTLYDRSLDMHVSNLRKKLGSHPDGSPRILALRGRGYYYSH


>gb|LT673656.1|-|1884345-1885022|Pseudomonas aeruginosa CpxR [Pseudomonas aeruginosa]
ATGAGCGAACTGCTGTTGATCGACGATGACCGGGAGCTCTGCGAGCTGCTCGGTACCTGGCTGGTCCAGGAAGGTTTCTCCGTGCGTGCC
AGCCACGACGGCGCCCAGGCCCGTCGCGCCCTCGCCGAGCAGACACCGGATGCCGTGGTGCTCGACGTGATGCTGCCGGACGGTAGCGGC
CTGGAACTGCTCAAGCAACTGCGCGGCGACCATCCCGACCTGCCGGTGCTGATGCTGTCCGCCCGCGGCGAGCCGCTGGACCGCATCCTC
GGTCTGGAACTGGGCGCCGACGACTACCTGGCCAAGCCCTGCGACCCGCGCGAACTCACCGCACGGCTGCGCGCCGTGCTGCGGCGAACC
CACCCGGCGCAACCCAGCGCGCAGATGCAACTGGGCGACCTGTCGCTGAACCTGACGCGCGGCGTGGCGCAGATCGACGGCCAGGAGATC
AGCCTGACCCTTTCCGAAAGCCGCATCCTCGAAGCGCTCCTGCGCCAGCCCGGCGAGCCGCTGGACAAGCAGGCCCTGGCGCAACTGGCG
CTGGGCCGCAAGCTGACCCTCTACGACCGCAGCCTGGACATGCACGTCAGCAACCTGCGCAAGAAGCTCGGCAGCCACCCCGACGGCAGC
CCGCGCATCCTCGCCCTGCGCGGCCGCGGCTACTACTACAGCCACTGA