Pseudomonas aeruginosa CpxR

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004054
CARD Short NamePaer_CpxR
DefinitionCpxR is directly involved in activation of expression of RND efflux pump MexAB-OprM in P. aeruginosa. CpxR is required to enhance mexAB-oprM expression and drug resistance, in the absence of repressor MexR.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, sulfonamide antibiotic, diaminopyrimidine antibiotic, aminocoumarin antibiotic, penicillin beta-lactam, cephalosporin, aminoglycoside antibiotic, phenicol antibiotic, tetracycline antibiotic, carbapenem, monobactam, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification58 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ nonribosomal peptide antibiotics [Drug Class]
+ mechanism of antibiotic resistance
+ lipopeptide antibiotic
+ beta-lactam antibiotic
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ antibiotic mixture
+ sulfonamide antibiotic [Drug Class]
+ diaminopyrimidine antibiotic [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ aminocoumarin antibiotic [Drug Class]
+ penicillin beta-lactam [Drug Class]
+ cephalosporin [Drug Class]
+ polymyxin antibiotic
+ aminoglycoside antibiotic [Drug Class]
+ penicillin with extended spectrum
+ third-generation cephalosporin [Drug Subclass]
+ gentamicin [Antibiotic]
+ protein(s) or two-component regulatory system modulating antibiotic efflux [Efflux Regulator]
+ phenicol antibiotic [Drug Class]
+ sulfamethoxazole [Antibiotic]
+ trimethoprim [Antibiotic]
+ novobiocin [Antibiotic]
+ tetracycline antibiotic [Drug Class]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ colistin
+ tobramycin [Antibiotic]
+ kanamycin A [Antibiotic]
+ carbapenem [Drug Class]
+ amikacin [Antibiotic]
+ neomycin [Antibiotic]
+ monobactam [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ macrolide antibiotic [Drug Class]
+ antibiotic efflux regulatory protein [AMR Gene Family]
+ AcrAD-TolC
+ trimethoprim-sulfamethoxazole [Antibiotic]
+ panipenem [Antibiotic]
+ MdtABC-TolC
+ ampicillin [Antibiotic]
+ colistin B [Antibiotic]
+ colistin A [Antibiotic]
+ aztreonam [Antibiotic]
+ acrD
+ chloramphenicol [Antibiotic]
+ azithromycin [Antibiotic]
+ meropenem [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftazidime [Antibiotic]
+ tetracycline [Antibiotic]
+ ciprofloxacin [Antibiotic]
+ erythromycin [Antibiotic]
+ protein of two-component regulatory system modulating antibiotic efflux
+ cpxAR
+ MexAB-OprM
Parent Term(s)1 ontology terms | Show
+ CpxR
Resistomes with Perfect MatchesPseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsPseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg
Publications

Tian ZX, et al. 2016. PLoS Pathog. 12(10):e1005932 CpxR Activates MexAB-OprM Efflux Pump Expression and Enhances Antibiotic Resistance in Both Laboratory and Clinical nalB-Type Isolates of Pseudomonas aeruginosa. (PMID 27736975)

Resistomes

Prevalence of Pseudomonas aeruginosa CpxR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa99.54%1.17%96%0%0%
Pseudomonas fluorescens2.78%0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|SIP52035.1|-|Pseudomonas aeruginosa CpxR [Pseudomonas aeruginosa]
MSELLLIDDDRELCELLGTWLVQEGFSVRASHDGAQARRALAEQTPDAVVLDVMLPDGSGLELLKQLRGDHPDLPVLMLSARGEPLDRIL
GLELGADDYLAKPCDPRELTARLRAVLRRTHPAQPSAQMQLGDLSLNLTRGVAQIDGQEISLTLSESRILEALLRQPGEPLDKQALAQLA
LGRKLTLYDRSLDMHVSNLRKKLGSHPDGSPRILALRGRGYYYSH


>gb|LT673656.1|-|1884345-1885022|Pseudomonas aeruginosa CpxR [Pseudomonas aeruginosa]
ATGAGCGAACTGCTGTTGATCGACGATGACCGGGAGCTCTGCGAGCTGCTCGGTACCTGGCTGGTCCAGGAAGGTTTCTCCGTGCGTGCC
AGCCACGACGGCGCCCAGGCCCGTCGCGCCCTCGCCGAGCAGACACCGGATGCCGTGGTGCTCGACGTGATGCTGCCGGACGGTAGCGGC
CTGGAACTGCTCAAGCAACTGCGCGGCGACCATCCCGACCTGCCGGTGCTGATGCTGTCCGCCCGCGGCGAGCCGCTGGACCGCATCCTC
GGTCTGGAACTGGGCGCCGACGACTACCTGGCCAAGCCCTGCGACCCGCGCGAACTCACCGCACGGCTGCGCGCCGTGCTGCGGCGAACC
CACCCGGCGCAACCCAGCGCGCAGATGCAACTGGGCGACCTGTCGCTGAACCTGACGCGCGGCGTGGCGCAGATCGACGGCCAGGAGATC
AGCCTGACCCTTTCCGAAAGCCGCATCCTCGAAGCGCTCCTGCGCCAGCCCGGCGAGCCGCTGGACAAGCAGGCCCTGGCGCAACTGGCG
CTGGGCCGCAAGCTGACCCTCTACGACCGCAGCCTGGACATGCACGTCAGCAACCTGCGCAAGAAGCTCGGCAGCCACCCCGACGGCAGC
CCGCGCATCCTCGCCCTGCGCGGCCGCGGCTACTACTACAGCCACTGA

Curator Acknowledgements
Curator Description Most Recent Edit