KPC-134

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3007857
CARD Short NameKPC-134
DefinitionKPC-134 is an inhibitor-resistant KPC-2 variant which confers resistance to ceftazidime-avibactam.
AMR Gene FamilyOXA-1-like beta-lactamase, class A Mycobacterium abscessus beta-lactamase, MOX beta-lactamase, ACT beta-lactamase, CMY beta-lactamase, KPC beta-lactamase, IMP beta-lactamase, CTX-M beta-lactamase, SHV beta-lactamase, TEM beta-lactamase
Drug Classpenicillin beta-lactam, azole antibiotic, cephalosporin, imidazole antibiotic, carbapenem, monobactam
Resistance Mechanismantibiotic inactivation
Classification89 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ mechanism of antibiotic resistance
+ determinant of antibiotic resistance
+ antibiotic molecule
+ antibiotic inactivation [Resistance Mechanism]
+ antibiotic inactivation enzyme
+ hydrolysis of antibiotic conferring resistance
+ beta-lactam antibiotic
+ hydrolysis of beta-lactam antibiotic by serine beta-lactamase
+ penicillin beta-lactam [Drug Class]
+ beta-lactamase
+ beta-lactamase resistant penicillin
+ hydrolysis of beta-lactam antibiotic by metallo-beta-lactamase
+ class C beta-lactamase
+ resistance-modifying agents
+ penicillin with extended spectrum
+ azole antibiotic [Drug Class]
+ inhibitor of antibiotic resistance mechanism
+ CMY-LAT-MOX beta-lactamase
+ class A beta-lactamase
+ class D beta-lactamase
+ class B (metallo-) beta-lactamase
+ oxacillin [Antibiotic]
+ cephalosporin [Drug Class]
+ third-generation cephalosporin [Drug Subclass]
+ second-generation cephalosporin [Drug Subclass]
+ first-generation cephalosporin [Drug Subclass]
+ imidazole antibiotic [Drug Class]
+ ampicillin [Antibiotic]
+ subclass B1 (metallo-) beta-lactamase
+ SHV-LEN beta-lactamase
+ CMY-MOX beta-lactamase
+ CMY-LAT beta-lactamase
+ beta-lactamase inhibitor
+ OXA beta-lactamase
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ OXA-1-like beta-lactamase [AMR Gene Family]
+ class A Mycobacterium abscessus beta-lactamase [AMR Gene Family]
+ serine beta-lactamase inhibitor
+ ticarcillin [Antibiotic]
+ cefalotin [Antibiotic]
+ cefixime [Antibiotic]
+ MOX beta-lactamase [AMR Gene Family]
+ ACT beta-lactamase [AMR Gene Family]
+ CMY beta-lactamase [AMR Gene Family]
+ KPC beta-lactamase [AMR Gene Family]
+ IMP beta-lactamase [AMR Gene Family]
+ CTX-M beta-lactamase [AMR Gene Family]
+ SHV beta-lactamase [AMR Gene Family]
+ TEM beta-lactamase [AMR Gene Family]
+ piperacillin [Antibiotic]
+ ertapenem [Antibiotic]
+ amoxicillin [Antibiotic]
+ cefuroxime [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftazidime [Antibiotic]
+ cefazolin [Antibiotic]
+ MAB
+ diazabicyclooctane
+ KPC-3
+ KPC-2
+ IMP-4
+ MOX-1
+ CMY-8
+ CTX-M-65
+ CTX-M-55
+ CTX-M-27
+ CTX-M-24
+ CTX-M-15
+ ACT-1
+ OXA-1
+ SHV-52
+ SHV-18
+ SHV-7
+ SHV-4
+ SHV-3
+ SHV-2
+ SHV-1
+ TEM-71
+ TEM-28
+ TEM-26
+ TEM-12
+ TEM-10
+ TEM-9
+ TEM-3
+ TEM-1
+ antibiotic mixture
+ avibactam [Adjuvant]
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ KPC beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ceftazidime-avibactam [Antibiotic+Adjuvant]
Publications

Huang X, et al. 2023. Microbiol Spectr 11(5):e0072523 Emergence of KPC-134, a KPC-2 variant associated with ceftazidime-avibactam resistance in a ST11 Klebsiella pneumoniae clinical strain. (PMID 37772834)

Resistomes

Prevalence of KPC-134 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|UVJ69199.1|+|KPC-134 [Klebsiella pneumoniae]
MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLL
DTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARATS
SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDD
NRAPNKDDKHSEAVIAAAARLALEGLGVNGQ


>gb|OP293349.1|+|6-911|KPC-134 [Klebsiella pneumoniae]
ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCG
GAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGC
GCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTG
GACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAG
CTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTC
ATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGCTACCTCA
TCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTA
AAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTAT
GGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGAC
AACCGGGCGCCTAACAAGGATGACAAGCACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGG
CAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit