Accession ARO:3000237
DefinitionTolC is a protein subunit of many multidrug efflux complexes in Gram negative bacteria. It is an outer membrane efflux protein and is constitutively open. Regulation of efflux activity is often at its periplasmic entrance by other components of the efflux complex.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, major facilitator superfamily (MFS) antibiotic efflux pump, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, tetracycline antibiotic, macrolide antibiotic, fluoroquinolone antibiotic, glycylcycline, phenicol antibiotic, triclosan, aminocoumarin antibiotic, carbapenem, monobactam, diaminopyrimidine antibiotic, penam, aminoglycoside antibiotic, acridine dye, antibacterial free fatty acids, cephalosporin, oxazolidinone antibiotic, rhodamine, rifamycin antibiotic, penem, isoniazid, benzalkonium chloride, fosfomycin, bicyclomycin, cephamycin, lincosamide antibiotic, nitroimidazole antibiotic, nucleoside antibiotic, pleuromutilin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia colig+wgs, Klebsiella oxytocawgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Classification73 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ peptide antibiotic [Drug Class]
+ mechanism of antibiotic resistance
+ lipopeptide antibiotic
+ tetracycline antibiotic [Drug Class]
+ antibiotic without defined classification
+ beta-lactam antibiotic
+ determinant of antibiotic resistance
+ antibiotic efflux [Resistance Mechanism]
+ macrolide antibiotic [Drug Class]
+ fluoroquinolone antibiotic [Drug Class]
+ cephem
+ glycylcycline [Drug Class]
+ phenicol antibiotic [Drug Class]
+ triclosan [Drug Class]
+ aminocoumarin antibiotic [Drug Class]
+ antibiotic mixture
+ polymyxin antibiotic
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ diaminopyrimidine antibiotic [Drug Class]
+ penam [Drug Class]
+ aminoglycoside antibiotic [Drug Class]
+ acridine dye [Drug Class]
+ efflux pump complex or subunit conferring antibiotic resistance [Efflux Component]
+ antibacterial free fatty acids [Drug Class]
+ cephalosporin [Drug Class]
+ oxazolidinone antibiotic [Drug Class]
+ rhodamine [Drug Class]
+ rifamycin antibiotic [Drug Class]
+ penem [Drug Class]
+ polymyxin B
+ isoniazid [Drug Class]
+ benzalkonium chloride [Drug Class]
+ fosfomycin [Drug Class]
+ bicyclomycin [Drug Class]
+ cephamycin [Drug Class]
+ lincosamide antibiotic [Drug Class]
+ nitroimidazole antibiotic [Drug Class]
+ nucleoside antibiotic [Drug Class]
+ pleuromutilin antibiotic [Drug Class]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ spectinomycin [Antibiotic]
+ cloxacillin [Antibiotic]
+ polymyxin B1 [Antibiotic]
+ tetracycline [Antibiotic]
+ polymyxin B2 [Antibiotic]
+ norfloxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ polymyxin B4 [Antibiotic]
+ AcrEF-TolC
+ ciprofloxacin [Antibiotic]
+ polymyxin B3 [Antibiotic]
+ erythromycin [Antibiotic]
+ nalidixic acid [Antibiotic]
+ gentamicin C [Antibiotic]
+ piperacillin [Antibiotic]
+ azithromycin [Antibiotic]
+ tobramycin [Antibiotic]
+ imipenem [Antibiotic]
+ ATP-binding cassette (ABC) antibiotic efflux pump [AMR Gene Family]
+ cefalotin [Antibiotic]
+ novobiocin [Antibiotic]
+ tigecycline [Antibiotic]
+ ceftazidime [Antibiotic]
+ chloramphenicol [Antibiotic]
+ ticarcillin [Antibiotic]
+ streptomycin [Antibiotic]
+ ertapenem [Antibiotic]
+ ampicillin [Antibiotic]
+ oxacillin [Antibiotic]
+ rifampin [Antibiotic]
Parent Term(s)10 ontology terms | Show
Publications

Koronakis V. 2003. FEBS Lett 555(1): 66-71. TolC--the bacterial exit duct for proteins and drugs. (PMID 14630321)

Koronakis V, et al. 2000. Nature 405(6789): 914-919. Crystal structure of the bacterial membrane protein TolC central to multidrug efflux and protein export. (PMID 10879525)

Sharff A, et al. 2001. Eur J Biochem 268(19): 5011-5026. The role of the TolC family in protein transport and multidrug efflux. From stereochemical certainty to mechanistic hypothesis. (PMID 11589692)

Andersen C, et al. 2002. Proc Natl Acad Sci U S A 99(17): 11103-11108. Transition to the open state of the TolC periplasmic tunnel entrance. (PMID 12163644)

Nishino K, et al. 2005. Mol Microbiol 59(1): 126-141. Virulence and drug resistance roles of multidrug efflux systems of Salmonella enterica serovar Typhimurium. (PMID 16359323)

Resistomes

Prevalence of TolC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.04%
Acinetobacter nosocomialis0%0%2%
Citrobacter freundii0%0%0%
Enterobacter hormaechei0%0%0.16%
Escherichia coli13.02%0%86.4%
Klebsiella oxytoca0%0%0.93%
Klebsiella pneumoniae0%0%0%
Morganella morganii0%0%0%
Proteus mirabilis0%0%0%
Pseudomonas putida0%0%0%
Salmonella enterica0%0%0.05%
Shigella dysenteriae100%0%100%
Shigella flexneri100%0%99.48%
Shigella sonnei100%0%100%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 900


>gb|ACN32294.1|+|tolC [Escherichia coli]
MQMKKLLPILIGLSLSGFSSLSQAENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGINSNATS
ASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQN
ARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLP
TLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINA
SISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPVSTN
PENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN


>gb|FJ768952|+|1-1488|tolC [Escherichia coli]
ATGCAAATGAAGAAATTGCTCCCCATTCTTATCGGCCTGAGCCTTTCTGGGTTCAGTTCGTTGAGCCAGGCCGAGAACCTGATGCAAGTT
TATCAGCAAGCACGCCTTAGTAACCCGGAATTGCGTAAGTCTGCCGCCGATCGTGATGCTGCCTTTGAAAAAATTAATGAAGCGCGCAGT
CCATTACTGCCACAGCTAGGTTTAGGTGCAGATTACACCTATAGCAACGGCTACCGCGACGCGAACGGCATCAACTCTAACGCGACCAGT
GCGTCCTTGCAGTTAACTCAATCCATTTTTGATATGTCGAAATGGCGTGCGTTAACGCTGCAGGAAAAAGCAGCAGGGATTCAGGACGTC
ACGTATCAGACCGATCAGCAAACCTTGATCCTCAACACCGCGACCGCTTATTTCAACGTGTTGAATGCTATTGACGTTCTTTCCTATACA
CAGGCACAAAAAGAAGCGATCTACCGTCAATTAGATCAAACCACCCAACGTTTTAACGTGGGCCTGGTAGCGATCACCGACGTGCAGAAC
GCCCGCGCACAGTACGATACCGTGCTGGCGAACGAAGTGACCGCACGTAATAACCTTGATAACGCGGTAGAGCAGCTGCGCCAGATCACC
GGTAACTACTATCCGGAACTGGCTGCGCTGAATGTCGAAAACTTTAAAACCGACAAACCACAGCCGGTTAACGCGCTGCTGAAAGAAGCC
GAAAAACGCAACCTGTCGCTGTTACAGGCACGCTTGAGCCAGGACCTGGCGCGCGAGCAAATTCGCCAGGCGCAGGATGGTCACTTACCG
ACTCTGGATTTAACGGCTTCTACCGGGATTTCTGACACCTCTTATAGCGGTTCGAAAACCCGTGGTGCCGCTGGTACCCAGTATGACGAT
AGCAATATGGGCCAGAACAAAGTTGGCCTGAGCTTCTCGCTGCCGATTTATCAGGGCGGAATGGTTAACTCGCAGGTGAAACAGGCACAG
TACAACTTTGTCGGTGCCAGCGAGCAACTGGAAAGTGCCCATCGTAGCGTCGTGCAGACCGTGCGTTCCTCCTTCAACAACATTAATGCA
TCTATCAGTAGCATTAACGCCTACAAACAAGCCGTAGTTTCCGCTCAAAGCTCATTAGACGCGATGGAAGCGGGCTACTCGGTCGGTACG
CGTACCATTGTTGATGTGTTGGATGCGACCACCACGTTGTACAACGCCAAGCAAGAGCTGGCGAATGCGCGTTATAACTACCTGATTAAT
CAGCTGAATATTAAGTCAGCTCTGGGTACGTTGAACGAGCAGGATCTGCTGGCACTGAACAATGCGCTGAGCAAACCGGTTTCCACTAAT
CCGGAAAACGTTGCACCGCAAACGCCGGAACAGAATGCTATTGCTGATGGTTATGCGCCTGATAGCCCGGCACCAGTCGTTCAGCAAACA
TCCGCACGCACTACCACCAGTAACGGTCATAACCCTTTCCGTAACTGA